(data stored in ACNUC7421 zone)

HOGENOMDNA: AGRVS_6.PE1

AGRVS_6.PE1          Location/Qualifiers
FT   CDS_pept        203..1024
FT                   /locus_tag="Avi_0001"
FT                   /gene_family="HOG000218052" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:222147016"
FT                   /db_xref="GeneID:7387188"
FT                   /translation="MENRKNFFHLHLISDSTGETLISAGRAAAVQFPHSNPIEHVYPLV
FT                   RNRRQADAVLQSIDKEPGIVLYTIVDPELADFIDRRCIEIGVPSVNVLEPVIGTFQAYL
FT                   GPLARRRVGAQHVMNADYFARIEALNYTMDHDDGQMAEDYDQADVVLVGISRTSKTPTS
FT                   IYLANRGIKTANIPIVPDSPLPESLFAAKGPLIVGLIATSDRISQVRGHRELGTVSGFD
FT                   PSDYTDRASIAEELKYARSLCARHNWPVIDVTRRSIEETAAAIIALRAKPR"
FT                   /protein_id="YP_002547973.1"
     GTGGAGAACA GAAAAAACTT CTTTCATCTG CACCTCATTT CTGACTCAAC GGGAGAAACA        60
     CTGATCTCGG CTGGACGGGC AGCAGCGGTT CAGTTTCCGC ATTCCAATCC GATCGAGCAT       120
     GTCTATCCGC TGGTGCGCAA CCGCCGGCAG GCGGATGCCG TGCTCCAATC AATCGATAAG       180
     GAACCCGGCA TCGTGCTTTA CACCATTGTC GATCCGGAGC TGGCGGACTT TATTGATCGG       240
     CGTTGTATCG AGATCGGTGT ACCCAGCGTT AACGTGCTTG AGCCTGTTAT CGGGACGTTT       300
     CAGGCCTATC TTGGTCCACT GGCGCGTCGG CGCGTCGGCG CCCAGCATGT GATGAATGCC       360
     GATTATTTTG CGCGTATCGA GGCGCTGAAT TACACGATGG ATCACGATGA TGGCCAGATG       420
     GCCGAGGATT ACGATCAGGC CGACGTCGTT CTGGTAGGGA TCAGTCGTAC GTCGAAAACC       480
     CCGACCAGCA TCTATCTTGC CAATCGTGGC ATTAAGACCG CCAATATTCC CATCGTGCCA       540
     GATTCGCCCT TACCGGAATC GCTGTTCGCT GCAAAAGGGC CATTGATCGT TGGATTGATC       600
     GCCACGTCTG ATCGAATTTC ACAAGTTCGC GGCCATCGTG AATTGGGGAC TGTCAGTGGT       660
     TTCGATCCAA GCGATTATAC GGACAGGGCG AGCATTGCGG AAGAATTGAA ATATGCCCGT       720
     TCGCTGTGTG CCCGTCACAA TTGGCCGGTC ATTGATGTGA CGCGGCGATC AATTGAAGAG       780
     ACAGCGGCGG CAATCATTGC GCTGCGTGCC AAGCCGCGCT AA                          822
//

If you have problems or comments...

PBIL Back to PBIL home page