(data stored in ACNUC1829 zone)

EMBL: AH004897.CD37

AH004897.CD37        Location/Qualifiers
FT   CDS_pept        join(57..125,213..285,428..552,635..709,1031..1135,
FT                   1538..1774,2034..2117,2273..2350)
FT                   /codon_start=1
FT                   /gene="Cd37"
FT                   /product="leukocyte surface antigen CD37"
FT                   /protein_id="AAB39500.1"
FT                   /translation="MSAQESCLSLIKYFLFVFNLFFFVLGGLIFCFGTWILIDKTSFVS
FT                   FVGLSFVPLQTWSKVLAVSGVLTMALALLGCVGALKELRCLLGLYFGMLLLLFATQITL
FT                   GILISTQRVRLERRVQELVLRTIQSYRTNPDETAAEESWDYAQFQLRCCGWQSPRDWNK
FT                   AQMLKANESEEPFVPCSCYNSTATNDSTVFDKLFFSQLSRLGPRAKLRQTADICALPAK
FT                   AHIYREGCAQSLQKWLHNNIISIVGICLGVGLLELGFMTLSIFLCRNLDHVYDRLARYR
FT                   "
     atgtccgccc aagagagttg cctcagcctc atcaagtact tcctcttcgt tttcaacctc        60
     ttcttctttg tactaggcgg cctgattttc tgcttcggca cctggatcct cattgacaag       120
     accagcttcg tgtcctttgt gggtttgtcc ttcgtgccac tgcagacttg gtccaaggtc       180
     ctggctgtct caggtgtcct caccatggcc ctggctctcc tgggctgtgt gggggctcta       240
     aaggagctgc gctgtctcct gggcctgtat tttggaatgc tgctgctcct gtttgccaca       300
     cagattaccc tgggcatcct catttctact cagcgggtcc ggctggagcg aagggtgcag       360
     gaattggtgt tgcggacgat ccagagctac cgcacgaatc cggatgagac agcagccgag       420
     gagagttggg actatgcaca gttccagctg cgctgctgcg gctggcaatc tccgcgggac       480
     tggaacaagg cccagatgct gaaagcgaac gagtctgagg agccctttgt gccctgctcc       540
     tgctacaact ccacggcgac caatgactcc accgtctttg ataagctctt tttctcccag       600
     ctaagccggt tggggccgcg ggcgaagctg aggcagactg ctgacatatg tgcactccct       660
     gcaaaagccc acatctaccg tgagggctgc gcgcagagcc tccagaagtg gctgcacaac       720
     aatatcatct ccatagtggg aatctgtctg ggagtcggtc ttcttgagct cggcttcatg       780
     acgctctcaa tattcctgtg tagaaatctg gatcacgtct atgaccggct ggcccggtac       840
     cgctag                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page