(data stored in ACNUC23119 zone)

EMBL: AH006036.PE2

AH006036.PE2         Location/Qualifiers
FT   CDS_pept        join(955..1181,1713..1811,2300..2488,2978..3035,3645..3717,
FT                   4264..4424,4884..4966,5580..5733,6230..6301,6912..6977,
FT                   7481..7537,8259..8383,8768..8906,9298..9430,9985..10132,
FT                   10787..10844,11233..11341,11821..11876)
FT                   /codon_start=1
FT                   /gene="P"
FT                   /product="P protein, truncated"
FT                   /protein_id="AAC13783.1"
FT                   /translation="MHLEGRDGRRYPGAPAVELLQTSVPSGLAELVAGKRRLPRGAGGA
FT                   DPSHSCPRGAAGQSSWAPAGQEFASFLTKGRSHSSLPQMSSSRSKDSCFTENTPLLRNS
FT                   LQEKGSRCIPVYHPEFITAEESWEDSSADWERRYLLSREVSGLSASASSEKGDLLDSPH
FT                   IRLRLSKLRRCVQWLKVMGLFAFVVLCSILFSLYPDQGKLWQLLALSPLENYSVNLSSH
FT                   VDSTLLQVDLAGALVASGPSRPGREEHIVVELTQADALGSRWRRPQQVTHNWTVYLNPR
FT                   RSEHSVMSRTFEVLTRETVSISIRASLQQTQAVPLLMAHQYLRGSVETQVTIATAILAG
FT                   VYALIIFEIVHRTLAAMLGSLAALAALAVIGDRPSLTHVVEWIDFETLALLFGMMILVA
FT                   IFSETGFFDYCAVKAYRLSRGRVWAMIIMLCLIAAVLSAFLDNVTTMLLFTPVTIRLCE
FT                   VLNLDPRQVLIAEVIFTNIGGAATAIGDPPNVIIVSNQELRKMGLDFAGFTAHMFIGIC
FT                   LVLLVCFPLLRLLYWNRKLYNKEPSEIVELKHEIHVWRLTAQRISPASREETAVRRLLL
FT                   GKVLALEHLLARRLHTFHRQISQEDKNWETNIQELQKKHRISDGILLAKCLTVLGFVIF
FT                   MFFLNSFVPGIHLDLGGLGLVQAGRYYLSTPES"
     atgcatctgg agggcagaga cggcaggcgg taccccggcg cgccggcggt ggagctcctg        60
     cagacgtccg tgcccagcgg actcgctgaa cttgtggccg gcaagcgcag gcttcctcgg       120
     ggagccggtg gagctgaccc ctcgcactcc tgccccaggg gggctgccgg gcagagctct       180
     tgggctcctg caggccagga gtttgcttca ttcctcacaa aagggaggtc tcactcttct       240
     ttgccccaga tgtccagctc caggtctaaa gattcctgct ttacagaaaa cactcctttg       300
     ctgaggaatt ccttacagga gaaagggtca cggtgcatac ctgtttacca tccagagttc       360
     atcactgctg aagagtcttg ggaagacagc tctgctgact gggagcgaag atacctgcta       420
     agcagggagg tgtctggtct gtctgcatct gcctcctccg agaagggaga ccttctggac       480
     agcccgcaca tccgactccg tctttccaag ctgaggcgct gtgtgcagtg gctgaaagtc       540
     atgggcctgt ttgcctttgt ggtgctgtgt tctattttgt tcagcctata tccggatcaa       600
     ggaaagctct ggcagctgtt ggccttatca ccgctggaga actactccgt gaaccttagc       660
     agccacgtgg actccacgct gctgcaggtg gacctggcag gggccctagt ggccagtggg       720
     ccgagtcgtc ctgggaggga agagcacatc gtggtggagc tgacccaggc tgacgctttg       780
     ggctccaggt ggcggcggcc acagcaggtc actcacaact ggacggtgta tttaaatccg       840
     aggagaagcg agcactcagt gatgagcagg acctttgagg tactgaccag agagacggtg       900
     tccatcagca tccgggcctc cctgcagcag acccaggctg tccctctttt gatggctcat       960
     cagtacctcc gcggaagtgt agaaacccag gtgaccatcg cgacggccat cctcgcgggc      1020
     gtctacgcgc tgatcatatt tgagatcgtg cacagaactc tggcggccat gctgggttcc      1080
     cttgcagcac tggcagcact ggctgtgatt ggcgatagac ccagcctgac ccatgtggtg      1140
     gagtggattg attttgagac gctggccctg ctgtttggca tgatgatctt agtagccata      1200
     ttttcagaaa cgggattttt cgattattgt gctgtaaagg cataccggct ctcccgggga      1260
     cgggtgtggg ccatgatcat catgctctgt ctcatcgcgg ccgtcctctc tgccttcttg      1320
     gacaacgtca ccaccatgct cctcttcacg cctgtgacca taaggttgtg tgaggtgctc      1380
     aaccttgatc caagacaagt cctgattgca gaagtgatct tcacaaacat tggaggagct      1440
     gccactgcca tcggggaccc tccaaatgtc attattgttt ccaaccaaga gctgaggaag      1500
     atgggcctgg actttgccgg attcactgca cacatgttca ttgggatttg ccttgttctc      1560
     ctggtctgct ttccgctcct cagactcctt tactggaaca gaaagcttta taacaaggaa      1620
     cccagtgaga ttgttgaact gaagcacgag attcacgtct ggcgcctgac tgctcagcgc      1680
     atcagcccgg ccagccgcga ggagacagct gtgcgccgcc tgctgctggg gaaggtgctg      1740
     gcactggagc acctgctcgc ccggaggctg cacaccttcc acagacagat ctcacaggag      1800
     gacaaaaatt gggagaccaa tatccaagaa ctccaaaaaa agcataggat atctgacggg      1860
     attctgctcg ccaaatgcct gacagtgttg ggatttgtta tcttcatgtt tttcctcaat      1920
     tcgtttgtcc ctggcattca tcttgatctt ggtggcctgg gcttggttca agctggcagg      1980
     tattatttat ccacacctga gagctga                                          2007
//

If you have problems or comments...

PBIL Back to PBIL home page