(data stored in ACNUC8465 zone)

EMBL: AH006187.MKK4

AH006187.MKK4        Location/Qualifiers
FT   CDS_pept        join(115..229,418..520,795..969,1233..1352,1604..1723,
FT                   1911..1962,2216..2343,2584..2661,2945..3093,3313..3358,
FT                   3589..3702)
FT                   /codon_start=1
FT                   /gene="MKK4"
FT                   /product="mitogen-activated protein kinase kinase 1"
FT                   /note="tumor-suppressor"
FT                   /protein_id="AAC24130.1"
FT                   /translation="MAAPSPSGGGGSGGGSGSGTPGPVGSPAPGHPAVSSMQGKRKALK
FT                   LNFANPPFKSTARFTLNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKD
FT                   LGEIGRGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQ
FT                   FYGALFREGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKEN
FT                   LKIIHRDIKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASR
FT                   QGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSF
FT                   INFVNLCLTKDESKRPKYKELLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD
FT                   "
     atggcggctc cgagcccgag cggcggcggc ggctccgggg gcggcagcgg cagcggcacc        60
     cccggccccg tagggtcccc ggcgccaggc cacccggccg tcagcagcat gcagggtaaa       120
     cgcaaagcac tgaagttgaa ttttgcaaat ccacctttca aatctacagc aaggtttact       180
     ctgaatccca atcctacagg agttcaaaac ccacacatag agagactgag aacacacagc       240
     attgagtcat caggaaaact gaagatctcc cctgaacaac actgggattt cactgcagag       300
     gacttgaaag accttggaga aattggacga ggagcttatg gttctgtcaa caaaatggtc       360
     cacaaaccaa gtgggcaaat aatggcagtt aaaagaattc ggtcaacagt ggatgaaaaa       420
     gaacaaaaac aacttcttat ggatttggat gtagtaatgc ggagtagtga ttgcccatac       480
     attgttcagt tttatggtgc actcttcaga gagggtgact gttggatctg tatggaactc       540
     atgtctacct cgtttgataa gttttacaaa tatgtatata gtgtattaga tgatgttatt       600
     ccagaagaaa ttttaggcaa aatcacttta gcaactgtga aagcactaaa ccacttaaaa       660
     gaaaacttga aaattattca cagagatatc aaaccttcca atattcttct ggacagaagt       720
     ggaaatatta agctctgtga cttcggcatc agtggacagc ttgtggactc tattgccaag       780
     acaagagatg ctggctgtag gccatacatg gcacctgaaa gaatagaccc aagcgcatca       840
     cgacaaggat atgatgtccg ctctgatgtc tggagtttgg ggatcacatt gtatgagttg       900
     gccacaggcc gatttcctta tccaaagtgg aatagtgtat ttgatcaact aacacaagtc       960
     gtgaaaggag atcctccgca gctgagtaat tctgaggaaa gggaattctc cccgagtttc      1020
     atcaactttg tcaacttgtg ccttacgaag gatgaatcca aaaggccaaa gtataaagag      1080
     cttctgaaac atccctttat tttgatgtat gaagaacgtg ccgttgaggt cgcatgctat      1140
     gtttgtaaaa tcctggatca aatgccagct actcccagct ctcccatgta tgtcgattga      1200
//

If you have problems or comments...

PBIL Back to PBIL home page