(data stored in ACNUC31183 zone)

EMBL: AJ628446.RAP1GA2

AJ628446.RAP1GA2     Location/Qualifiers
FT   CDS_pept        91..2283
FT                   /gene="RAP1GA2"
FT                   /product="Rap1 GTPase activating protein 2b"
FT                   /db_xref="GOA:Q684P5"
FT                   /db_xref="H-InvDB:HIT000249324_01.9"
FT                   /db_xref="HGNC:HGNC:29176"
FT                   /db_xref="InterPro:IPR000331"
FT                   /db_xref="InterPro:IPR035974"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q684P5"
FT                   /protein_id="CAF31652.1"
FT                   /translation="MFGRKRSVSFGGFGWIDKTMLASLKVKKQELANSSDATLPDRPLS
FT                   PPLTAPPTMKSSEFFEMLEKMQGIKLEEQKPGPQKNKDDYIPYPSIDEVVEKGGPYPQV
FT                   ILPQFGGYWIEDPENVGTPTSLGSSICEEEEEDNLSPNTFGYKLECKGEARAYRRHFLG
FT                   KDHLNFYCTGSSLGNLILSVKCEEAEGIEYLRVILRSKLKTVHERIPLAGLSKLPSVPQ
FT                   IAKAFCDDAVGLRFNPVLYPKASQMIVSYDEHEVNNTFKFGVIYQKARQTLEEELFGNN
FT                   EESPAFKEFLDLLGDTITLQDFNGFRGGLDVTHGQTGVESVYTTFRDREIMFHVSTKLP
FT                   FTDGDAQQLQRKRHIGNDIVAIIFQEENTPFVPDMIASNFLHAYIVVQVETPGTETPSY
FT                   KVSVTAREDVPTFGPPLPSPPVFQKGPEFREFLLTKLTNAENACCKSDKFAKLEDRTRA
FT                   ALLDNLHDELHAHTQAMLGLGPEEDKFENGGHGGFLESFKRAIRVRSHSMETMVGGQKK
FT                   SHSGGIPGSLSGGISHNSMEVTKTTFSPPVVAATVKNQSRSPIKRRSGLFPRLHTGSEG
FT                   QGDSRARCDSTSSTPKTPDGGHSSQEIKSETSSNPSSPEICPNKEKPFMKLKENGRAIS
FT                   RSSSSTSSVSSTAGEGEAMEEGDSGGSQPSTTSPFKQEVFVYSPSPSSESPSLGAAATP
FT                   IIMSRSPTDAKSRNSPRSNLKFRFDKLSHASSGAGH"
     atgtttggcc ggaagcgcag tgtctccttt gggggcttcg gatggatcga caagaccatg        60
     ctggcaagtc tgaaggtcaa gaagcaggag ctggccaaca gctcggatgc gaccctccca       120
     gaccggccgc tctcccctcc tctcacggca cctcccacca tgaagtcgtc ggagttcttt       180
     gagatgctgg agaaaatgca ggggatcaag cttgaagagc agaagccggg accccagaag       240
     aacaaggacg actatatccc ataccccagc atcgacgagg ttgtggagaa gggaggcccg       300
     taccctcagg tcatcctgcc acagtttggg ggctattgga tcgaggaccc ggagaacgtg       360
     ggcaccccaa catcgctggg gagcagcatc tgtgaggagg aggaagagga caacctcagc       420
     cccaacacat ttggctacaa gctcgagtgc aagggtgaag ccagggccta ccggaggcac       480
     ttcctgggga aggatcatct aaacttttac tgtaccggca gcagcctggg gaacttgatc       540
     ctgtccgtca agtgcgagga agcagagggg atcgagtacc tccgggtcat cctcaggtcc       600
     aaactgaaga cggtacatga gcggatcccc ttggctggac tgagcaagct tcccagtgtc       660
     cctcagattg caaaggcttt ctgtgatgat gcagtgggac tgagattcaa tcctgtcctg       720
     taccccaagg cctcccaaat gattgtgtcc tatgatgagc atgaagtcaa caacacattc       780
     aaattcggag tcatttatca aaaagccagg cagaccctgg aggaggagct atttgggaac       840
     aatgaggaga gcccagcttt taaggagttc ttggacctgc tgggggacac gatcacactg       900
     caggatttca atggtttccg aggaggcctg gacgtgaccc acggacagac aggggtggaa       960
     tcagtgtaca caacattccg ggacagggag atcatgtttc acgtttccac aaagctgcca      1020
     tttaccgacg gagacgccca gcagctccag agaaagagac acattggaaa tgacatcgtg      1080
     gccatcatct tccaagagga aaacacgccg tttgtcccag acatgatagc ctccaatttc      1140
     ttacatgcct acatcgtcgt gcaggtcgag accccaggca cagagacccc atcctacaag      1200
     gtctctgtca ctgcgcggga agatgtgccc acctttggtc cacctctgcc cagtcccccc      1260
     gttttccaga agggcccgga attcagggag tttctgctca ccaagctcac caatgccgag      1320
     aacgcctgct gcaagtcgga caagtttgca aagctggagg accggaccag ggctgccctc      1380
     ctggacaacc ttcacgatga gctccacgcc cacacacagg ccatgctggg actgggccca      1440
     gaggaggaca agtttgagaa tggaggccac ggggggttcc tggagtcttt taagagggcc      1500
     atccgcgtac gcagccactc catggagacc atggtgggcg gccagaagaa gtcgcacagt      1560
     gggggcatcc ctggcagcct cagcgggggc atctcccaca acagcatgga ggtcaccaag      1620
     accaccttct cgcctccagt ggtggcggca acggtgaaga accagtcacg gagtcccatc      1680
     aagcgacgct cggggctctt cccccgcctg cacacgggct cagaaggcca gggcgacagc      1740
     cgggcacgat gtgacagcac atccagcaca cccaagaccc cagatggtgg acactcctct      1800
     caggagataa agtctgagac ctcatccaat cccagctctc cagaaatctg ccccaacaag      1860
     gagaagccct tcatgaagtt gaaggaaaac ggccgcgcca tctcccgctc ctcctccagc      1920
     accagcagcg tcagcagcac tgcaggggag ggcgaggcca tggaggaggg cgacagtggg      1980
     ggcagccagc cgtccacgac ctcacccttc aagcaggagg tgtttgtcta cagcccgtcc      2040
     ccgagcagcg agagccccag cctgggggca gctgccaccc caatcatcat gagccggagt      2100
     cccacagatg ccaaaagcag aaactccccg agatcgaacc tgaaattccg ctttgacaag      2160
     ctcagccatg ccagctctgg tgcgggtcac taa                                   2193
//

If you have problems or comments...

PBIL Back to PBIL home page