(data stored in ACNUC31183 zone)

EMBL: AJ628447.RAP1GA2

AJ628447.RAP1GA2     Location/Qualifiers
FT   CDS_pept        91..2238
FT                   /gene="RAP1GA2"
FT                   /product="Rap1 GTPase activating protein 2a"
FT                   /db_xref="GOA:Q684P5"
FT                   /db_xref="H-InvDB:HIT000249325_01.9"
FT                   /db_xref="HGNC:HGNC:29176"
FT                   /db_xref="InterPro:IPR000331"
FT                   /db_xref="InterPro:IPR035974"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q684P5"
FT                   /protein_id="CAF31653.1"
FT                   /translation="MFGRKRSVSFGGFGWIDKTMLASLKVKKQELANSSDATLPDRPLS
FT                   PPLTAPPTMKSSEFFEMLEKMQDDYIPYPSIDEVVEKGGPYPQVILPQFGGYWIEDPEN
FT                   VGTPTSLGSSICEEEEEDNLSPNTFGYKLECKGEARAYRRHFLGKDHLNFYCTGSSLGN
FT                   LILSVKCEEAEGIEYLRVILRSKLKTVHERIPLAGLSKLPSVPQIAKAFCDDAVGLRFN
FT                   PVLYPKASQMIVSYDEHEVNNTFKFGVIYQKARQTLEEELFGNNEESPAFKEFLDLLGD
FT                   TITLQDFNGFRGGLDVTHGQTGVESVYTTFRDREIMFHVSTKLPFTDGDAQQLQRKRHI
FT                   GNDIVAIIFQEENTPFVPDMIASNFLHAYIVVQVETPGTETPSYKVSVTAREDVPTFGP
FT                   PLPSPPVFQKGPEFREFLLTKLTNAENACCKSDKFAKLEDRTRAALLDNLHDELHAHTQ
FT                   AMLGLGPEEDKFENGGHGGFLESFKRAIRVRSHSMETMVGGQKKSHSGGIPGSLSGGIS
FT                   HNSMEVTKTTFSPPVVAATVKNQSRSPIKRRSGLFPRLHTGSEGQGDSRARCDSTSSTP
FT                   KTPDGGHSSQEIKSETSSNPSSPEICPNKEKPFMKLKENGRAISRSSSSTSSVSSTAGE
FT                   GEAMEEGDSGGSQPSTTSPFKQEVFVYSPSPSSESPSLGAAATPIIMSRSPTDAKSRNS
FT                   PRSNLKFRFDKLSHASSGAGH"
     atgtttggcc ggaagcgcag tgtctccttt gggggcttcg gatggatcga caagaccatg        60
     ctggcaagtc tgaaggtcaa gaagcaggag ctggccaaca gctcggatgc gaccctccca       120
     gaccggccgc tctcccctcc tctcacggca cctcccacca tgaagtcgtc ggagttcttt       180
     gagatgctgg agaaaatgca ggacgactat atcccatacc ccagcatcga cgaggttgtg       240
     gagaagggag gcccgtaccc tcaggtcatc ctgccacagt ttgggggcta ttggatcgag       300
     gacccggaga acgtgggcac cccaacatcg ctggggagca gcatctgtga ggaggaggaa       360
     gaggacaacc tcagccccaa cacatttggc tacaagctcg agtgcaaggg tgaagccagg       420
     gcctaccgga ggcacttcct ggggaaggat catctaaact tttactgtac cggcagcagc       480
     ctggggaact tgatcctgtc cgtcaagtgc gaggaagcag aggggatcga gtacctccgg       540
     gtcatcctca ggtccaaact gaagacggta catgagcgga tccccttggc tggactgagc       600
     aagcttccca gtgtccctca gattgcaaag gctttctgtg atgatgcagt gggactgaga       660
     ttcaatcctg tcctgtaccc caaggcctcc caaatgattg tgtcctatga tgagcatgaa       720
     gtcaacaaca cattcaaatt cggagtcatt tatcaaaaag ccaggcagac cctggaggag       780
     gagctatttg ggaacaatga ggagagccca gcttttaagg agttcttgga cctgctgggg       840
     gacacgatca cactgcagga tttcaatggt ttccgaggag gcctggacgt gacccacgga       900
     cagacagggg tggaatcagt gtacacaaca ttccgggaca gggagatcat gtttcacgtt       960
     tccacaaagc tgccatttac cgacggagac gcccagcagc tccagagaaa gagacacatt      1020
     ggaaatgaca tcgtggccat catcttccaa gaggaaaaca cgccgtttgt cccagacatg      1080
     atagcctcca atttcttaca tgcctacatc gtcgtgcagg tcgagacccc aggcacagag      1140
     accccatcct acaaggtctc tgtcactgcg cgggaagatg tgcccacctt tggtccacct      1200
     ctgcccagtc cccccgtttt ccagaagggc ccggaattca gggagtttct gctcaccaag      1260
     ctcaccaatg ccgagaacgc ctgctgcaag tcggacaagt ttgcaaagct ggaggaccgg      1320
     accagggctg ccctcctgga caaccttcac gatgagctcc acgcccacac acaggccatg      1380
     ctgggactgg gcccagagga ggacaagttt gagaatggag gccacggggg gttcctggag      1440
     tcttttaaga gggccatccg cgtacgcagc cactccatgg agaccatggt gggcggccag      1500
     aagaagtcgc acagtggggg catccctggc agcctcagcg ggggcatctc ccacaacagc      1560
     atggaggtca ccaagaccac cttctcgcct ccagtggtgg cggcaacggt gaagaaccag      1620
     tcacggagtc ccatcaagcg acgctcgggg ctcttccccc gcctgcacac gggctcagaa      1680
     ggccagggcg acagccgggc acgatgtgac agcacatcca gcacacccaa gaccccagat      1740
     ggtggacact cctctcagga gataaagtct gagacctcat ccaatcccag ctctccagaa      1800
     atctgcccca acaaggagaa gcccttcatg aagttgaagg aaaacggccg cgccatctcc      1860
     cgctcctcct ccagcaccag cagcgtcagc agcactgcag gggagggcga ggccatggag      1920
     gagggcgaca gtgggggcag ccagccgtcc acgacctcac ccttcaagca ggaggtgttt      1980
     gtctacagcc cgtccccgag cagcgagagc cccagcctgg gggcagctgc caccccaatc      2040
     atcatgagcc ggagtcccac agatgccaaa agcagaaact ccccgagatc gaacctgaaa      2100
     ttccgctttg acaagctcag ccatgccagc tctggtgcgg gtcactaa                   2148
//

If you have problems or comments...

PBIL Back to PBIL home page