(data stored in ACNUC1829 zone)

EMBL: AJ851687.PE1

AJ851687.PE1         Location/Qualifiers
FT   CDS_pept        243..743
FT                   /locus_tag="RCJMB04_17m6"
FT                   /product="hypothetical protein"
FT                   /note="ORF1"
FT                   /db_xref="GOA:Q5F3G3"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F3G3"
FT                   /protein_id="CAH65321.1"
FT                   /translation="MMFVGFLGCYGAIQESQCLLGAFFTCLVILFACEVAAGIWGFVNK
FT                   DQIAKDVKQFYDQAFQQALMADSDSSNGKAVVKTFHETLDCCGPDTMVGTLTPLWRDDL
FT                   CSKDLLKGLLKREENCHKKIDELFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNS
FT                   SVY"
     atgatgttcg tgggcttcct gggatgctac ggtgcaatcc aggagtcgca gtgccttctg        60
     ggggcgttct tcacctgcct ggtgattctg tttgcctgtg aggttgcagc tggaatctgg       120
     gggtttgtca acaaagacca gatagccaaa gacgtgaagc agttctacga ccaagcgttc       180
     caacaggcgc tcatggcgga ttcggactcg agcaacggga aggctgtggt gaagactttc       240
     catgaaacgt tggactgctg tggtcctgat actatggttg gaacgctcac tcctctgtgg       300
     agagatgacc tgtgctcgaa ggacttactg aaaggcttgc tgaagcgtga ggaaaactgc       360
     cacaaaaaga tcgacgagct cttctctggg aagctgtacc tgatcggtat tgctgccatc       420
     gtggttgccg tgatcatgat cttcgaaatg atcctgagca tggtgctgtg ctgcggcata       480
     aggaacagct ccgtctactg a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page