(data stored in ACNUC21562 zone)

EMBL: AK029369.PE1

AK029369.PE1         Location/Qualifiers
FT   CDS_pept        68..1084
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="MrgB2 G protein-coupled receptor (SPTR|Q91ZC2,
FT                   evidence: FASTY, 99.7%ID, 100%length, match=1014)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3KNA1"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="InterPro:IPR026234"
FT                   /db_xref="MGI:MGI:2441674"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KNA1"
FT                   /protein_id="BAC26422.1"
FT                   /translation="MSGDFLIKNLSTSAWKTNITVLNGSYYFDTSVCVTRNQAMILLSI
FT                   IISLVGMGLNAIVLWFLGIRMHTNAFTVYILNLAMADFLYLCSQFVICLLIAFYIFYSI
FT                   DINIPLVLYVVPIFAYLSGLSILSTISIERCLSVIWPIWYRCKRPRHTSAITCFVLWVM
FT                   SLLLGLLEGKACGLLFNSFDSYWCETFDVITNIWSVVFFGVLCGSSLTLLVRIFCGSQR
FT                   IPMTRLYVTITLTVLVFLIFGLPFGIYWILYQWISNFYYVEICNFYLEILFLSCVNSCM
FT                   NPIIYFLVGSIRHRRFRRKTLKLLLQRAMQDTPEEEQSGNKSSSEHPEELETVQSCS"
     atgagtggag atttcctaat caagaatcta agcacctcag cctggaaaac gaacatcaca        60
     gtgctgaatg gaagctacta cttcgatact tcagtttgtg tcaccaggaa ccaagccatg       120
     attttgcttt ccatcatcat ttccctggtt gggatgggac taaatgccat agtgctgtgg       180
     ttcctgggca tccgtatgca cacgaatgcc ttcactgtct acattctcaa cctggctatg       240
     gctgactttc tttacctgtg ctctcagttt gtaatttgtc ttcttattgc cttttatatc       300
     ttctactcaa ttgacatcaa catccctttg gttctttatg ttgtgccaat atttgcttat       360
     ctttcaggtc tgagcattct cagcaccatt agcattgagc gctgcttgtc tgtaatatgg       420
     cccatttggt atcgctgtaa acgtccaaga cacacatcag ctatcacatg ttttgtgctt       480
     tgggttatgt ccttattgtt gggtctcctg gaagggaagg catgtggctt actgtttaat       540
     agctttgact cttattggtg tgaaacattt gatgttatca ctaatatatg gtcagttgtt       600
     ttttttggtg ttctctgtgg gtctagcctc accctgcttg tcaggatctt ctgtggctca       660
     cagcgaattc ctatgaccag gctgtatgtg actattacac tcacagtctt ggtcttcctg       720
     atctttggtc ttccctttgg gatctattgg atactctatc agtggattag caatttttat       780
     tatgttgaaa tttgtaattt ttatcttgag atactattcc tatcctgtgt taacagctgt       840
     atgaacccca tcatttattt ccttgttggc tccattaggc accgaaggtt caggcggaag       900
     actctcaagc tacttctgca gagagccatg caagacaccc ctgaggagga acaaagtgga       960
     aataagagtt cttcagaaca ccctgaagaa ctggaaactg ttcagagctg cagctga         1017
//

If you have problems or comments...

PBIL Back to PBIL home page