(data stored in ACNUC24361 zone)

EMBL: AK095261.PE1

AK095261.PE1         Location/Qualifiers
FT   CDS_pept        905..2125
FT                   /codon_start=1
FT                   /note="highly similar to Zinc finger protein 323"
FT                   /db_xref="GOA:B3KTA4"
FT                   /db_xref="H-InvDB:HIT000020116.20"
FT                   /db_xref="InterPro:IPR003309"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR038269"
FT                   /db_xref="UniProtKB/TrEMBL:B3KTA4"
FT                   /protein_id="BAG53016.1"
FT                   /translation="MASTEEQYDLKIVKVEEDPIWDQETHLRGNNFSGQEASRQLFRQF
FT                   CYQESPGPREALSRLRELCHQWLRPEIHTKEQILELLVLEQFLTILPEELQAWVREHHP
FT                   ESGEEAVAVVEDLEQELSEPGNQAPDHEHGHSEVLLEDVEHLKVKQEPTDIQLQPMVTQ
FT                   LRYESFCLHQFQEQDGESIPENQELASKQEILKEMEHLGDSRLQRDVSLDSKYRETCKR
FT                   DSKAEKQQAHSTGERRHRCNECGKSFTKSSVLIEHQRIHTGEKPYECEECGKAFSRRSS
FT                   LNEHRRSHTGEKPYQCKECGKAFSASNGLTRHRRIHTGEKPYECKVCGKAFLLSSCLVQ
FT                   HQRIHTGEKRYQCRECGKAFIQNAGLFQHLRVHTGEKPYQCSQCSKLFSKRTLLKKHQK
FT                   IHTGERP"
     atggcttcaa cagaggaaca gtacgatctt aagattgtga aagtggagga agaccctatc        60
     tgggaccaag aaacccacct tcgagggaac aacttttctg gccaagaagc ctcccgacaa       120
     ctttttaggc agttttgtta ccaagagtct cctggtcccc gagaagctct gagccggctc       180
     cgagaactct gtcatcagtg gctaaggcca gaaatccaca ccaaagagca aatcttggag       240
     ctgctggtgc tggagcaatt cctgactatc ctgcctgagg agctccaggc ctgggtgcgg       300
     gagcaccatc cggagagtgg ggaggaggct gtggctgtag ttgaagatct ggaacaagag       360
     cttagtgagc cagggaacca ggctccagac catgaacatg gacattctga agtgctcttg       420
     gaggatgtgg aacatctgaa ggtcaagcag gaaccaacag acatacagct tcagcctatg       480
     gtgacacagc tcagatatga atctttttgc ctccaccaat ttcaagaaca agatggtgaa       540
     agtatacctg agaaccagga gttggcatca aagcaagaaa tcttaaaaga aatggaacat       600
     ttgggggata gcagactcca aagagatgta tctttggatt ctaagtacag agaaacttgt       660
     aaacgagaca gcaaggcaga aaagcagcag gcacattcca ctggagagag acgccacagg       720
     tgcaatgaat gtgggaaaag cttcactaag agttcagtac tcattgagca ccagagaatc       780
     cacactgggg agaagccata tgaatgtgaa gaatgtggga aggccttcag ccggaggtca       840
     agcctgaatg aacatcggcg gagccacact ggagagaaac cctatcaatg taaggagtgt       900
     gggaaagcct tcagtgccag caatggcctc actcgacaca gaagaatcca cacaggggaa       960
     aaaccatatg aatgcaaagt gtgtgggaag gctttcctcc tcagctcatg ccttgttcag      1020
     catcagagga tacacactgg agagaagcgc tatcagtgtc gtgagtgtgg caaagccttc      1080
     attcagaatg cagggctttt ccagcatctc cgagtccaca ctggtgagaa accctatcag      1140
     tgcagtcagt gcagtaaact ctttagtaag cggacacttc ttaagaaaca tcagaaaatc      1200
     cacactggag agagaccata a                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page