(data stored in ACNUC7421 zone)

EMBL: AK140990.PE1

AK140990.PE1         Location/Qualifiers
FT   CDS_pept        93..2081
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 3,
FT                   X-linked (MGD|MGI:103064 GB|NM_010028, evidence: BLASTN,
FT                   99%, match=3185)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3TQX5"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:103064"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TQX5"
FT                   /protein_id="BAE24540.1"
FT                   /translation="MSHVAVENALGLDQQFAGLDLNSSDNQSGGSTASKGRYIPPHLRN
FT                   REATKGFYDKDSSGWSSSKDKDAYSSFGSRGDSRGKSSFFGDRGSGSRGRFDDRGRGDY
FT                   DGIGGRGDRSGFGKFERGGNSRWCDKSDEDDWSKPLPPSERLEQELFSGGNTGINFEKY
FT                   DDIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMA
FT                   CAQTGSGKTAAFLLPILSQIYADGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQ
FT                   IYEEARKFSYRSRVRPCVVYGGAEIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDF
FT                   CKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDE
FT                   YIFLAVGRVGSTSENITQKVVWVEEIDKRSFLLDLLNATGKDSLTLVFVETKKGADSLE
FT                   DFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFD
FT                   LPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAF
FT                   EHHYKGSSRGRSKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGGGHGGSRGFG
FT                   GGGYGGFYNSDGYGGNYNSQGVDWWGN"
     atgagtcatg tggcagtgga aaatgcgctc gggctggacc agcagtttgc tggcctagac        60
     ctgaactctt cagataatca gagtggagga agtacagcaa gcaaagggcg ttatatccca       120
     cctcatttaa ggaacagaga agctactaaa ggattctatg acaaagacag ttcagggtgg       180
     agttctagta aagataagga tgcatacagc agttttggat cacggggtga ttcaagaggg       240
     aagtctagct tctttggaga tcgtggaagt ggatcaaggg gaaggtttga tgatcgtgga       300
     cggggagact atgatggcat tggtggccgt ggagatagaa gtggctttgg caaatttgaa       360
     agaggtggaa atagtcgctg gtgtgacaaa tcagatgaag atgactggtc aaagccactc       420
     ccaccaagtg aacgattgga acaggaactc ttttctggag gcaatactgg gattaacttt       480
     gagaaatatg atgacattcc agtcgaagca acaggcaaca actgtcctcc acacattgaa       540
     agtttcagtg atgtcgagat gggagaaatt attatgggaa acattgagct tactcgttat       600
     actcgcccaa ctccagtgca gaagcatgct attcctatta tcaaagagaa aagagacttg       660
     atggcttgtg ctcaaacagg ctctggaaaa actgcagcat ttctcttgcc catcttgagt       720
     cagatctatg ctgatggtcc aggagaagct ctgagggcta tgaaggaaaa tggaagatat       780
     ggccgtcgta aacagtatcc aatctctttg gtactggcac caacgagaga attggcagtg       840
     cagatctatg aggaagccag aaaattctca taccgatcta gagtccgtcc ttgcgtggtt       900
     tatggtggtg ctgaaattgg ccagcagatt cgagacttag aacgtggatg ccacttgtta       960
     gtagccactc caggacgtct agtggatatg atggagagag ggaagatcgg gttagacttc      1020
     tgcaaatacc tggtgttaga tgaagctgac cggatgttag atatggggtt tgaacctcag      1080
     atacgaagaa tagttgaaca agacactatg cctccaaaag gtgtccgcca cactatgatg      1140
     tttagtgcta cttttcctaa ggaaatacag atgctggccc gtgatttctt agatgagtac      1200
     atatttctgg ctgtaggaag agttgggtct acttcagaga acatcacaca aaaagtggtt      1260
     tgggtggagg agatagacaa aaggtcattt ctgcttgacc ttctaaatgc aacaggcaag      1320
     gattccctga ctctagtgtt tgtggagaca aaaaaggggg cagattcgct ggaggatttc      1380
     ttataccatg aaggatatgc ttgtaccagt atccatggag accgttctca gagagatagg      1440
     gaagaggccc ttcaccagtt ccgctcagga aaaagcccaa ttctagtggc tacagcagta      1500
     gcagcaagag gactggatat ttcaaatgtg aagcatgtta ttaattttga cctgcctagt      1560
     gatatcgaag aatatgtgca tcgcataggc cgtacaggcc gtgtgggaaa ccttggtctt      1620
     gccacctcat tctttaatga aaggaatata aatatcacaa aggatttact ggatcttctt      1680
     gttgaagcaa aacaagaagt gccttcttgg ttagagaaca tggcttttga acaccactac      1740
     aagggtagca gtcgtggacg ttctaagagc agtcgattta gtggagggtt tggtgccaga      1800
     gactaccgac agagtagcgg tgccagcagt tccagcttca gcagcagccg tgcaagcagc      1860
     agtcgaagtg gtggaggtgg ccatggcggc agtcgaggat ttggtggagg tggctacgga      1920
     ggcttttaca acagtgatgg atatggaggg aattataact cccagggggt tgactggtgg      1980
     ggtaactga                                                              1989
//

If you have problems or comments...

PBIL Back to PBIL home page