(data stored in ACNUC1829 zone)

EMBL: AK155663.PE1

AK155663.PE1         Location/Qualifiers
FT   CDS_pept        89..847
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="CD37 antigen (MGD|MGI:88330 GB|NM_007645, evidence:
FT                   BLASTN, 99%, match=772)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3U1W9"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="MGI:MGI:88330"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U1W9"
FT                   /protein_id="BAE33374.1"
FT                   /translation="MSAQESCLSLIKYFLFVFNLFFFVLGGLIFCFGTWILIDKTSFVS
FT                   FVGLSFVPLQTWSKVLAVSGVLTMALALLGCVGALKELRCLLGLYFGMLLLLFATQITL
FT                   GILISTQRVRLERRVQELVLRTIQSYRTNPDETAAEESWDYAQFQLRCCGWQSPRDWNK
FT                   AQMLKANESEEPFVPCSCYNSTATNDSTVFDKLFFSQLSRLGPRAKLRQTADICALPAK
FT                   AHIYREVGLAVASSSGRVGLGLEPSGGRDF"
     atgtccgccc aagagagttg cctcagcctc atcaagtact tcctcttcgt tttcaacctc        60
     ttcttctttg tactaggcgg cctgattttc tgcttcggca cctggatcct cattgacaag       120
     accagcttcg tgtcctttgt gggtttgtcc ttcgtgccac tgcagacttg gtccaaggtc       180
     ctggctgtct caggtgtcct caccatggcc ctggctctcc tgggctgtgt gggggctcta       240
     aaggagctgc gctgtctcct gggcctgtat tttggaatgc tgctgctcct gtttgccaca       300
     cagattaccc tgggcatcct catttccact cagcgggtcc ggctggagcg aagggtgcag       360
     gaattggtgt tgaggacgat ccagagctac cgcacgaatc cggatgagac agcagccgag       420
     gagagttggg actatgcaca gttccagctg cgctgctgcg gctggcaatc tccgcgggac       480
     tggaacaagg cccagatgct gaaagcgaac gagtctgagg agccctttgt gccctgctcc       540
     tgctacaact ccacggcgac caatgactcc accgtctttg ataagctctt tttctcccag       600
     ctaagccggt tggggccgcg ggcgaagctg aggcagactg ctgacatatg tgcactccct       660
     gcaaaagctc acatctaccg tgaggtggga ctagcggtag ccagtagctc tggacgtgtg       720
     ggcctggggc tggagccgtc tggtgggagg gacttttaa                              759
//

If you have problems or comments...

PBIL Back to PBIL home page