(data stored in ACNUC1829 zone)

EMBL: AK158729.PE1

AK158729.PE1         Location/Qualifiers
FT   CDS_pept        68..787
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="Tetraspan NET-5 homolog (Hypothetical protein)
FT                   (UniProt|Q8BJU2, evidence: FASTY, 100%ID, 100%length,
FT                   match=717)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8BJU2"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="MGI:MGI:1924558"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BJU2"
FT                   /protein_id="BAE34632.1"
FT                   /translation="MARGCLCCLKYTMFLFNLIFWLCGCGLLGVGIWLSVSQGNFATFS
FT                   PSFPSLSAANLVIAIGTIVMVTGFLGCLGAIKENKCLLLSFFIVLLIILLAELILIILF
FT                   FVYMDKVNENAKQDLKEGLLLYNTENNVGLKNAWNIIQAEMRCCGVTDYTDWYPVLGEN
FT                   TVPDRCCMENSQGCGRNSTTPLWRTGCYEKVKLWFDDNKHVLGTVGMCILIMQILGMAF
FT                   SMTLFQHIHRTGKKYDA"
     atggccaggg gctgtctctg ctgcttgaag tacacgatgt tcctcttcaa tttgatattc        60
     tggctctgtg gctgtgggct gcttggagtg ggcatctggc tctctgtgtc ccaaggcaac       120
     ttcgccacct tctcccccag cttcccctca ctgtccgcag ccaacctcgt catcgccatc       180
     ggcaccatcg tcatggtgac gggcttcctg ggctgcctgg gggccatcaa ggagaacaag       240
     tgtctgcttc tcagcttctt catcgtgctg ttgatcatcc tgctggcaga gttgattctg       300
     atcatcctct tcttcgtcta catggacaag gtgaacgaga atgccaagca ggacctgaaa       360
     gaggggctgc tgctctacaa cacagagaac aacgtggggc tcaagaacgc ctggaacatc       420
     atccaggccg agatgcggtg ttgtggggtc actgactaca cagactggta tccggtgctc       480
     ggggagaaca cagttcctga cagatgctgc atggagaatt cccagggctg tgggcgcaac       540
     agcaccaccc ccttgtggag aacgggctgc tacgaaaaag tgaagctgtg gtttgatgac       600
     aacaagcacg tgctaggcac cgtgggcatg tgcatcctca tcatgcagat cctgggaatg       660
     gccttttcca tgacactgtt ccagcacatc caccggacag gtaaaaagta cgacgcctga       720
//

If you have problems or comments...

PBIL Back to PBIL home page