(data stored in ACNUC8465 zone)

EMBL: AK294923.PE1

AK294923.PE1         Location/Qualifiers
FT   CDS_pept        15..1145
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="highly similar to Dual specificity mitogen-activated
FT                   proteinkinase kinase 4 (EC 2.7.12.2)"
FT                   /db_xref="GOA:B4DH44"
FT                   /db_xref="H-InvDB:HIT000489547.4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:B4DH44"
FT                   /protein_id="BAG58005.1"
FT                   /translation="MAAPSPSGTPVSSMQGKRKALKLNFANPPFKSTARFTLNPNPTGV
FT                   QNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKMVHKPSGQI
FT                   MAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMELMSTSFD
FT                   KFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRSGNIKL
FT                   CDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYELATGR
FT                   FPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYKELLK
FT                   HPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD"
     atggcggctc cgagcccgag cggcaccccc gtcagcagca tgcagggtaa acgcaaagca        60
     ctgaagttga attttgcaaa tccacctttc aaatctacag caaggtttac tctgaatccc       120
     aatcctacag gagttcaaaa cccacacata gagagactga gaacacacag cattgagtca       180
     tcaggaaaac tgaagatctc ccctgaacaa cactgggatt tcactgcaga ggacttgaaa       240
     gaccttggag aaattggacg aggagcttat ggttctgtca acaaaatggt ccacaaacca       300
     agtgggcaaa taatggcagt taaaagaatt cggtcaacag tggatgaaaa agaacaaaaa       360
     caacttctta tggatttgga tgtagtaatg cggagtagtg attgcccata cattgttcag       420
     ttttatggtg cactcttcag agagggtgac tgttggatct gtatggaact catgtctacc       480
     tcgtttgata agttttacaa atatgtatat agtgtattag atgatgttat tccagaagaa       540
     attttaggca aaatcacttt agcaactgtg aaagcactaa accacttaaa agaaaacttg       600
     aaaattattc acagagatat caaaccttcc aatattcttc tggacagaag tggaaatatt       660
     aagctctgtg acttcggcat cagtggacag cttgtggact ctattgccaa gacaagagat       720
     gctggctgta ggccatacat ggcacctgaa agaatagacc caagcgcatc acgacaagga       780
     tatgatgtcc gctctgatgt ctggagtttg gggatcacat tgtatgagtt ggccacaggc       840
     cgatttcctt atccaaagtg gaatagtgta tttgatcaac taacacaagt cgtgaaagga       900
     gatcctccgc agctgagtaa ttctgaggaa agggaattct ccccgagttt catcaacttt       960
     gtcaacttgt gccttacgaa ggatgaatcc aaaaggccaa agtataaaga gcttctgaaa      1020
     catcccttta ttttgatgta tgaagaacgt gccgttgagg tcgcatgcta tgtttgtaaa      1080
     atcctggatc aaatgccagc tactcccagc tctcccatgt atgtcgattg a               1131
//

If you have problems or comments...

PBIL Back to PBIL home page