(data stored in ACNUC8465 zone)

HOGENOMDNA: AKKM8_1

ID   AKKM8_1; SV 1; empty ; DNA; empty ; PRO; 2664102 BP.
XX
AC   NC_010655;
XX
PR   Project: 58985;
XX
DE   Akkermansia muciniphila ATCC BAA-835, complete genome.
XX
OS   Akkermansia muciniphila ATCC BAA-835
OC   Bacteria; Verrucomicrobia; Verrucomicrobiae; Verrucomicrobiales;
OC   Verrucomicrobiaceae; Akkermansia.
XX
RN   [1]
RP   1-2664102
RA   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H.,
RA   Pitluck,S., Chain,P., Malfatti,S., Shin,M., Vergez,L., Lang,D.,
RA   Schmutz,J., Larimer,F., Land,M., Hauser,L., Kyrpides,N., Ivanova,N.,
RA   Smidt,H., Derrien,M., Plugge,C.M., Zoetendal,E.G., de Vos,W.M. and
RA   Richardson,P.;
RT   "Complete sequence of Akkermansia muciniphila ATCC BAA-835";
RL   Unpublished
XX
RN   [2]
RP   1-2664102
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (07-MAY-2008) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-2664102
RA   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H.,
RA   Pitluck,S., Chain,P., Malfatti,S., Shin,M., Vergez,L., Lang,D.,
RA   Schmutz,J., Larimer,F., Land,M., Hauser,L., Kyrpides,N., Ivanova,N.,
RA   Smidt,H., Derrien,M., Plugge,C.M., Zoetendal,E.G., de Vos,W.M. and
RA   Richardson,P.;
RT   "Direct Submission";
RL   Submitted (01-MAY-2008) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP001071.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4001612
CC   Source DNA available from Hauke Smidt (Hauke.Smidt@wur.nl)
CC   Bacteria available from ATCC: ATCC BAA-835
CC   Contacts: Hauke Smidt (Hauke.Smidt@wur.nl)
CC   David Bruce (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..2664102
FT                   /strain="ATCC BAA-835"
FT                   /mol_type="genomic DNA"
FT                   /organism="Akkermansia muciniphila ATCC BAA-835"
FT                   /db_xref="taxon:349741"
FT                   /culture_collection="ATCC:BAA-835"
FT   gene            complement(508..582)
FT                   /note="tRNA-Met3"
FT                   /db_xref="GeneID:6274466"
FT                   /locus_tag="Amuc_R0001"
FT   tRNA            complement(508..582)
FT                   /db_xref="GeneID:6274466"
FT                   /locus_tag="Amuc_R0001"
FT                   /product="tRNA-Met"
FT   gene            complement(793..1353)
FT                   /db_xref="GeneID:6275256"
FT                   /locus_tag="Amuc_0001"
FT   CDS_pept        complement(793..1353)
FT                   /locus_tag="Amuc_0001"
FT                   /gene_family="HOG000045854" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NUDIX hydrolase"
FT                   /transl_table="11"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: xcb:XC_3392 MutT-like
FT                   protein"
FT                   /db_xref="GI:187734517"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="GeneID:6275256"
FT                   /translation="MEQMEQPGEACLSLYRGKFLELLKEGRWEYVRRVNASGAVMIVAV
FT                   TKEGELLLVEEYRVPLHARTVGLPAGISGDEGEESTLQSARRELEEETGYRADSWTYLF
FT                   AGPSSPGLTTEMVSFYLAEDLHRISAGGGVAHENITVHRIPLPQVHDWLMEQMGQGKVV
FT                   DPKIFMGLYFLSCCGNGMGQKAS"
FT                   /protein_id="YP_001876629.1"
FT   misc_feature    complement(832..1317)
FT                   /note="nudix-type nucleoside diphosphatase, YffH/AdpP
FT                   family; Region: TIGR00052"
FT                   /db_xref="CDD:129162"
FT                   /locus_tag="Amuc_0001"
FT   misc_feature    complement(832..1242)
FT                   /note="ADP-ribose pyrophosphatase (ADPRase) catalyzes the
FT                   hydrolysis of ADP-ribose and a variety of additional
FT                   ADP-sugar conjugates to AMP and ribose-5-phosphate. Like
FT                   other members of the Nudix hydrolase superfamily, it
FT                   requires a divalent cation, such as...; Region:
FT                   ADPRase_NUDT5; cd03424"
FT                   /db_xref="CDD:72882"
FT                   /locus_tag="Amuc_0001"
FT   misc_feature    complement(order(835..837,844..846,856..858,892..897,
FT                   934..936,940..945,1006..1020,1024..1026,1030..1041,
FT                   1162..1164,1177..1179,1183..1185,1189..1191,1240..1242))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:72882"
FT                   /locus_tag="Amuc_0001"
FT   misc_feature    complement(order(1009..1011,1078..1080,1090..1092,
FT                   1138..1140,1180..1182,1237..1239))
FT                   /note="ADP-ribose binding site; other site"
FT                   /db_xref="CDD:72882"
FT                   /locus_tag="Amuc_0001"
FT   misc_feature    complement(order(943..945,1009..1011,1078..1080,1090..1092,
FT                   1138..1146,1180..1182))
FT                   /note="active site"
FT                   /db_xref="CDD:72882"
FT                   /locus_tag="Amuc_0001"
FT   misc_feature    complement(order(1069..1116,1120..1125,1129..1131,
FT                   1135..1143))
FT                   /note="nudix motif; other site"
FT                   /db_xref="CDD:72882"
FT                   /locus_tag="Amuc_0001"
FT   misc_feature    complement(order(943..945,1078..1080,1090..1092))
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:72882"
FT                   /locus_tag="Amuc_0001"
FT   gene            1882..3288
FT                   /db_xref="GeneID:6275253"
FT                   /locus_tag="Amuc_0002"
FT   CDS_pept        1882..3288
FT                   /locus_tag="Amuc_0002"
FT                   /gene_family="HOG000235658" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /transl_table="11"
FT                   /note="KEGG: dsy:DSY0001 ATPase involved in DNA replication
FT                   initiation; TIGRFAM: chromosomal replication initiator
FT                   protein DnaA; PFAM: AAA ATPase central domain protein;
FT                   Chromosomal replication initiator DnaA domain; Chromosomal
FT                   replication initiator DnaA; SMART: AAA ATPase"
FT                   /db_xref="GI:187734518"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="GeneID:6275253"
FT                   /translation="MTPPSELSATWSKITGALQTIMSPEVYGLWFPKFSLLEDSGKALT
FT                   LVCDDPMAALWVENSYTPELKQAAMLALGTERQIKFVCTDEVASMPAAEGQPQKASSRA
FT                   KTPQAADSPAAPVKKQRTSAARACLNDLYTFDSFVVYEDSRFAYQAGLSVAQSERALFN
FT                   PLFLYGKSGVGKTHLLQAIGHEVLHQDSSTNVVYVTGEQFANEFIDASRTQNGQSFTKL
FT                   RRKYRKADVLLVDDVQFISGKEKTVEEFLHTFDELFHAHKTIVICADAAACDISNLDPR
FT                   LAARLESGLTVELNLPDDNARLEILRSKRDRAGMNVSDEILEFLASRIQKSVRRLEGAL
FT                   LRVATFTSLSGDMPDIAKIEQLLRDILREETSRILTVDSIQKRVADFYELKVSDLTGKR
FT                   RPNSIAFPRQIAMYLSRRLTERSLKDIGQAFGGRDHGTVIHANKLVASRMEEDVRVRDI
FT                   VQRLEEELRD"
FT                   /protein_id="YP_001876630.1"
FT   misc_feature    1900..3285
FT                   /note="chromosomal replication initiation protein;
FT                   Reviewed; Region: dnaA; PRK00149"
FT                   /db_xref="CDD:166824"
FT                   /locus_tag="Amuc_0002"
FT   misc_feature    2320..2763
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Amuc_0002"
FT   misc_feature    2386..2409
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Amuc_0002"
FT   misc_feature    order(2389..2412,2584..2586,2692..2694)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Amuc_0002"
FT   misc_feature    2572..2589
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Amuc_0002"
FT   misc_feature    2734..2736
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Amuc_0002"
FT   misc_feature    3010..3279
FT                   /note="C-terminal domain of bacterial DnaA proteins. The
FT                   DNA-binding C-terminal domain of DnaA contains a
FT                   helix-turn-helix motif that specifically interacts with the
FT                   DnaA box, a 9-mer motif that occurs repetitively in the
FT                   replication origin oriC. Multiple...; Region: Bac_DnaA_C;
FT                   cd06571"
FT                   /db_xref="CDD:119330"
FT                   /locus_tag="Amuc_0002"
FT   misc_feature    order(3079..3081,3103..3108,3127..3129,3145..3153,
FT                   3178..3192,3199..3201,3208..3213)
FT                   /note="DnaA box-binding interface; other site"
FT                   /db_xref="CDD:119330"
FT                   /locus_tag="Amuc_0002"
FT   gene            3438..4373
FT                   /db_xref="GeneID:6275251"
FT                   /locus_tag="Amuc_0003"
FT   CDS_pept        3438..4373
FT                   /locus_tag="Amuc_0003"
FT                   /codon_start="1"
FT                   /product="ABC transporter related"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: tpd:Teth39_0506 ABC transporter related"
FT                   /db_xref="GI:187734519"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:6275251"
FT                   /translation="MIHADQLSKEFGRFQAVKNASFQIEKGEIVGFLGPNGAGKTTTLR
FT                   MLTGYLPPTSGTATIAGFDIVKNPLEARKHLGYLPEHVPLYDDQRVTEYLKFRARLKGI
FT                   SSRQIWPAVSKVVEQCGLDPVRRKMIRTLSKGYRQRVGLADALLGEPDLLILDEPTNGL
FT                   DPNQIRQIRELIKGLAANHTIILSTHILSEVEMICNKVIIIDQGTIKAADTPSNLTANL
FT                   RAAGKITLEFRGDLALITRKLENLEHVKKVIHEGTDADGWHTLTVRAEAGTDTREKAAR
FT                   LLAEQGCPLRHIYRHTPTLEEVFVEMTRKD"
FT                   /protein_id="YP_001876631.1"
FT   misc_feature    3441..4361
FT                   /note="gliding motility-associated ABC transporter
FT                   ATP-binding subunit GldA; Region: GldA_ABC_ATP; TIGR03522"
FT                   /db_xref="CDD:132561"
FT                   /locus_tag="Amuc_0003"
FT   misc_feature    3441..4064
FT                   /note="This family of ATP-binding proteins belongs to a
FT                   multisubunit transporter involved in drug resistance (BcrA
FT                   and DrrA), nodulation, lipid transport, and lantibiotic
FT                   immunity.  In bacteria and archaea, these transporters
FT                   usually include an ATP-binding...; Region:
FT                   ABC_DR_subfamily_A; cd03230"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="Amuc_0003"
FT   misc_feature    3537..3560
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="Amuc_0003"
FT   misc_feature    order(3546..3551,3555..3563,3678..3680,3906..3911,
FT                   4002..4004)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="Amuc_0003"
FT   misc_feature    3669..3680
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="Amuc_0003"
FT   misc_feature    3834..3863
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="Amuc_0003"
FT   misc_feature    3894..3911
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="Amuc_0003"
FT   misc_feature    3918..3929
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="Amuc_0003"
FT   misc_feature    3990..4010
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="Amuc_0003"
FT   gene            4429..5211
FT                   /db_xref="GeneID:6275247"
FT                   /locus_tag="Amuc_0004"
FT   CDS_pept        4429..5211
FT                   /locus_tag="Amuc_0004"
FT                   /gene_family="HOG000013494" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: scl:sce2430 hypothetical protein"
FT                   /db_xref="GI:187734520"
FT                   /db_xref="GeneID:6275247"
FT                   /translation="MSPVLTIFRKELRSYVMTPYGWVILAFVMALQSVSLSGTLKAFQL
FT                   APQKEGILFFILHSPMFWFYFLFIFPLLTMRSLAEEEKTGTLESLLTTPIKTWQVVLGK
FT                   YFSAYAFYIILWLPMLLYPILADWSNLIVQWIYGYDAGMVLPYRLADWAGAYAILLLVG
FT                   AWFTAIGIFASSMTGSQIISGIITIGLLVLIFFMGLIPVVWGEFPAAGIFHYMSCSEHL
FT                   DRFSAGLVDTRPVVFYLTMTVLTLAVTIRIIDHRRWKH"
FT                   /protein_id="YP_001876632.1"
FT   misc_feature    4441..5196
FT                   /note="ABC-2 type transporter; Region: ABC2_membrane;
FT                   cl11417"
FT                   /db_xref="CDD:164215"
FT                   /locus_tag="Amuc_0004"
FT   gene            5246..6817
FT                   /db_xref="GeneID:6275245"
FT                   /locus_tag="Amuc_0005"
FT   CDS_pept        5246..6817
FT                   /locus_tag="Amuc_0005"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: csc:Csac_0364 hypothetical protein"
FT                   /db_xref="GI:187734521"
FT                   /db_xref="GeneID:6275245"
FT                   /translation="MSETPDTPAAAAEASQPAARKVKRPWMTWIKLFLLFLIVVCLNYV
FT                   GCHEYYRRDLTEDQRYEISRQSINMLQSPEIQKRKTPVKITFAFLRTTQNYTRMRSLLE
FT                   EYERYSNGKVKVEYVDPLRQPNKAREISNIYGIEFKKNLVIIDAREDTEKALKTFEGTQ
FT                   ADAAHVRILPGDAFVVYAPGPDGKSMKAVALQIEDMMTAGIYGAANGEPRKIYIAADKS
FT                   NFNESLSNNQEESIFTTLGKICRSVNLQLVPIRMSGLEEIPEDAAGFMIIGSKYDLSPQ
FT                   EAEVLQWYWARPNAAILIMLEPQNDTPKQLYRFLREQGLRPQNDRVMLRNRGNRSVFEI
FT                   NSIFAPSLNCTREFWNSSTGLEGESISLILDSDNAAMEQKRITPYPLLVTTEDYYGETK
FT                   YNQFPAQFDAREDNPGPLMIGAALIRGNAGDVNQNKTTGRLVLLGNTDLLQPRQIKPEQ
FT                   RDFMRTLIGWMTDREELRGLGSRHDLTVKLNLDRNALGVLELLTNIGLPLLALLIALII
FT                   WNTRRH"
FT                   /protein_id="YP_001876633.1"
FT   misc_feature    5333..>6079
FT                   /note="gliding-associated putative ABC transporter
FT                   substrate-binding component GldG; Region: GldG; TIGR03521"
FT                   /db_xref="CDD:132560"
FT                   /locus_tag="Amuc_0005"
FT   misc_feature    5399..6229
FT                   /note="ABC-type uncharacterized transport system; Region:
FT                   ABC_transp_aux; pfam09822"
FT                   /db_xref="CDD:150486"
FT                   /locus_tag="Amuc_0005"
FT   gene            6846..8900
FT                   /db_xref="GeneID:6275243"
FT                   /locus_tag="Amuc_0006"
FT   CDS_pept        6846..8900
FT                   /locus_tag="Amuc_0006"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cyb:CYB_1660 lipoprotein, putative"
FT                   /db_xref="GI:187734522"
FT                   /db_xref="GeneID:6275243"
FT                   /translation="MRTFRFILLILITLASVGAAVLLMIDGNLSRIIGRTAFSSGERLF
FT                   PYTREEMNEVSWMRINCVGDVAEFRRKPNGVWWCEKPWNDRMDPRAAAAILQYTYSTSI
FT                   VDALPLHKIDSASLKEFGVKTTPVTITLKEMSDDGKRSSTVARYTLGSPAPWLVDDPEN
FT                   KTTDDTTYMQTDFYGRDTRILVGTGNILPLFKSGIRQLRDHRPLLLHPAMPASIEINNR
FT                   GQRIALERKTPGSPWKITYPLSLDTDPAMMDVLLGTLQKLTAVRVYNPEETSVPDMTDD
FT                   QITSVSIRNFTGRLSGDGKSLQMEEQPVTLRIYPPSDNGSLSELVKATVSDRKAVFELA
FT                   QTTETNKEVPGVRNIPLDLGLLRSKQLTDIGDYKITGLSIRKSFQDYPTIARFIQGDEK
FT                   KGIKPTWLYTVEGARYQEANPEHLISLLKTVKQGKVAGFASDKVTDLSVYGLDNPRMTL
FT                   TMSLLPKPGEEPRPPVTVFFSKGADGSWYARQAGKPTVAILDNAYMKDLLTDALAWKKK
FT                   RLFSFSRFDLREMHLERIGSGGPLVLKFDRLDDSWTASKDGKDETLNINPNRANRYLDE
FT                   LEKMEVSAWLPYTDATAHEALKNPVFRLKLILQSYKEAAPVQSQSGSSDITFAPEPETE
FT                   DKVITLEIAPAGEAGYSRFYYGRVNTTPNYFILNMDAVRLLGASLSEDN"
FT                   /protein_id="YP_001876634.1"
FT   sig_peptide     6846..6905
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.573 at
FT                   residue 20"
FT                   /locus_tag="Amuc_0006"
FT   gene            8914..9693
FT                   /db_xref="GeneID:6275241"
FT                   /locus_tag="Amuc_0007"
FT   CDS_pept        8914..9693
FT                   /locus_tag="Amuc_0007"
FT                   /gene_family="HOG000014258" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF34"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF34; KEGG:
FT                   dge:Dgeo_1982 protein of unknown function DUF34"
FT                   /db_xref="GI:187734523"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="GeneID:6275241"
FT                   /translation="MSKIELHTAISFLDGILSVNSIPDAPRALNGLQLENGGTVSKVAA
FT                   AVDGSEKAIHAALETGADLLLLHHGIFWQPMQPITGIAYRKLKAAMDGNLAIYAAHLPL
FT                   DVHPAYGNNALLAKACGLRPCSHDGLDYHGVSLGTHGEFPGTCAELEQKLETVLGAPVQ
FT                   AFWKDSPEAPAGDIFICTGGAGDDLAQAAALGCRTYVTGEGSHWNIPLAQELGVNLVFG
FT                   GHYFTETFGVKALGLLLKDVYGLDYTFIDLPPSAYSH"
FT                   /protein_id="YP_001876635.1"
FT   misc_feature    8923..9672
FT                   /note="Uncharacterized conserved protein [Function
FT                   unknown]; Region: COG0327"
FT                   /db_xref="CDD:30675"
FT                   /locus_tag="Amuc_0007"
FT   misc_feature    8941..9672
FT                   /note="NIF3 (NGG1p interacting factor 3); Region: NIF3;
FT                   cl01309"
FT                   /db_xref="CDD:174611"
FT                   /locus_tag="Amuc_0007"
FT   gene            9710..10681
FT                   /db_xref="GeneID:6275239"
FT                   /locus_tag="Amuc_0008"
FT   CDS_pept        9710..10681
FT                   /locus_tag="Amuc_0008"
FT                   /gene_family="HOG000275919" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /EC_number="3.2.1.17"
FT                   /note="KEGG: cyb:CYB_1113 pseudouridine synthase, RluA
FT                   family; TIGRFAM: pseudouridine synthase, RluA family; PFAM:
FT                   RNA-binding S4 domain protein; pseudouridine synthase"
FT                   /db_xref="GI:187734524"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="GeneID:6275239"
FT                   /translation="MNLTTDDADGKIRLDQYLAAHLPELSRSRIQSLIKSGDVLVNGSP
FT                   AKPKNPVSRGDSITVRIPEPEPAEAQPQDIPLDILYEDEDVVVINKESGMVVHPAAGNP
FT                   DGTIVNALLHHCGDLSGIGGVERPGIVHRLDKDTSGCLVIAKNDGAHQSLTAQFAARST
FT                   EKRYLAVVQGIPSQSSGTVFTHIGRHPVNRLKMAVVNPGSGKAAITDYDLLCADPSTDS
FT                   SLVLCTLHTGRTHQIRVHMLYLGHPLIGDPIYAKPARQKAKPGRLMLHAWRLGFDHPRT
FT                   GKRMDFEAPVPPEYTPWLQLFPNGLYGAIPELRPVQEDGGRN"
FT                   /transl_table="11"
FT                   /protein_id="YP_001876636.1"
FT   misc_feature    9743..9979
FT                   /note="S4/Hsp/ tRNA synthetase RNA-binding domain; The
FT                   domain surface is populated by conserved, charged residues
FT                   that define a likely RNA-binding site;  Found in stress
FT                   proteins, ribosomal proteins and tRNA synthetases; This may
FT                   imply a hitherto unrecognized...; Region: S4; cd00165"
FT                   /db_xref="CDD:29105"
FT                   /locus_tag="Amuc_0008"
FT   misc_feature    9746..10609
FT                   /note="pseudouridine synthase, RluA family; Region:
FT                   rluA_subfam; TIGR00005"
FT                   /db_xref="CDD:161659"
FT                   /locus_tag="Amuc_0008"
FT   misc_feature    order(9746..9748,9782..9787,9791..9796,9800..9805,
FT                   9812..9817,9821..9823,9842..9847,9848..9862,9866..9868)
FT                   /note="RNA binding surface; other site"
FT                   /db_xref="CDD:29105"
FT                   /locus_tag="Amuc_0008"
FT   misc_feature    9965..10537
FT                   /note="PseudoU_synth_RsuA/RluD: Pseudouridine synthase,
FT                   RsuA/RluD family. This group is comprised of eukaryotic,
FT                   bacterial and archeal proteins similar to eight site
FT                   specific Escherichia coli pseudouridine synthases: RsuA,
FT                   RluA, RluB, RluC, RluD, RluE, RluF...; Region:
FT                   PseudoU_synth_RluCD_like; cd02869"
FT                   /db_xref="CDD:30029"
FT                   /locus_tag="Amuc_0008"
FT   misc_feature    order(10103..10114,10421..10423)
FT                   /note="active site"
FT                   /db_xref="CDD:30029"
FT                   /locus_tag="Amuc_0008"
FT   gene            11054..12211
FT                   /db_xref="GeneID:6275237"
FT                   /locus_tag="Amuc_0009"
FT   CDS_pept        11054..12211
FT                   /locus_tag="Amuc_0009"
FT                   /gene_family="HOG000018971" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chorismate mutase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: chorismate mutase; PFAM: prephenate
FT                   dehydratase; Chorismate mutase; amino acid-binding ACT
FT                   domain protein; KEGG: rxy:Rxyl_1244 prephenate dehydratase"
FT                   /db_xref="GI:187734525"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR010957"
FT                   /db_xref="GeneID:6275237"
FT                   /translation="METTHHGEDASPDNPPRQQKSGNTDEQTIALTKARLAIDEVDARI
FT                   VELLKKRAEWVHEVGRIKKEKNSPIFVPERETALLNKLNRLNAGVLPEASLQAIYREII
FT                   SCSFFLEGGLTIAYLGPKGTWSHQAALKQFGKSCELIPCQSFKDVFDMVDRGKAQYGVV
FT                   PVENSSEGSVTAVMDLFVTSPLKICAQINLNIRNSLMADIPREHIRILYSHPQVLGQTR
FT                   NWIQRHFPNAELVETSSTTKASILAKENAAMGAASLGCPLAAELFGLNILEEDVQDQSC
FT                   NTTRFAVIGRQETQPSGRDRTSLLIRIQHKPGTLAEVVNCFQRHNNNLIRIESRPSKVI
FT                   NWEYVFYIDAAGHIQESPLRETLPELEQHCSMLKILGSYADTDVI"
FT                   /protein_id="YP_001876637.1"
FT   misc_feature    11156..11368
FT                   /note="Chorismate mutase type II; Region: CM_2; cl00693"
FT                   /db_xref="CDD:174351"
FT                   /locus_tag="Amuc_0009"
FT   misc_feature    11393..12190
FT                   /note="Prephenate dehydratase [Amino acid transport and
FT                   metabolism]; Region: PheA; COG0077"
FT                   /db_xref="CDD:30426"
FT                   /locus_tag="Amuc_0009"
FT   misc_feature    11399..11935
FT                   /note="Prephenate dehydratase; Region: PDT; pfam00800"
FT                   /db_xref="CDD:144409"
FT                   /locus_tag="Amuc_0009"
FT   misc_feature    11954..12190
FT                   /note="C-terminal ACT domain of the bifunctional chorismate
FT                   mutase-prephenate dehydratase (CM-PDT) enzyme and the
FT                   prephenate dehydratase (PDT) enzyme; Region: ACT_CM-PDT;
FT                   cd04905"
FT                   /db_xref="CDD:153177"
FT                   /locus_tag="Amuc_0009"
FT   misc_feature    order(11990..12001,12050..12061)
FT                   /note="putative L-Phe binding site; other site"
FT                   /db_xref="CDD:153177"
FT                   /locus_tag="Amuc_0009"
FT   gene            12257..13873
FT                   /db_xref="GeneID:6275236"
FT                   /locus_tag="Amuc_0010"
FT   CDS_pept        12257..13873
FT                   /locus_tag="Amuc_0010"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Alpha-L-fucosidase"
FT                   /EC_number="3.2.1.51"
FT                   /note="PFAM: glycoside hydrolase family 29
FT                   (alpha-L-fucosidase); KEGG: cpy:Cphy_3023
FT                   alpha-L-fucosidase"
FT                   /db_xref="GI:187734526"
FT                   /db_xref="InterPro:IPR000933"
FT                   /db_xref="GeneID:6275236"
FT                   /translation="MNIATIAALAVTLGLPAPAQQSATKIITENGQPALALDEQFAARL
FT                   RDGGMKQGSPATVPAEFSAAAPGLPLPADANHAAVRETAGERNRRMEWWRDAKFGMFIH
FT                   YGLYSGLAGEWKGRPGGSEWIQKNVEVDTDTYAAEALPLFKPREGLTEEWAQLARDAGC
FT                   QYVVLTSKHHEGFGLFDSALTDYDAKSAVNRDIIREYVDSCRKRGLKVGLYHSVIDWHH
FT                   PSYDNTICPDLCYPAGQAAMLNRKNIPRDHAAYQKYLHAQVRELMTRYAPIDIMWWDYS
FT                   QGAMEGAKGWKAPELMDMVRSINPGVIMNNRLYAYSGLNKNQAGTLDLRCGDYITPERF
FT                   IPRRGYPGVDWESCMTVSDKWGYNRYDTNIKSPETIIEKLVECVTKGGNLLLNVNPMAD
FT                   GTIPEKVAATMRGVGRWLNINGEAVYGTRAFMQLDQPATINRQGDIFIFLIPPPDKEPA
FT                   QPPSEGTMKELTAGAEHARMQPLDATGYENDGGTAVTLPAGYSKALLLGDNTALPVVNG
FT                   TVLFKAHEHSKTPCSVIKLSK"
FT                   /transl_table="11"
FT                   /protein_id="YP_001876638.1"
FT   sig_peptide     12257..12322
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.517 at
FT                   residue 22"
FT                   /locus_tag="Amuc_0010"
FT   misc_feature    12521..13543
FT                   /note="Alpha-L-fucosidase; Region: Alpha_L_fucos; cl12119"
FT                   /db_xref="CDD:159779"
FT                   /locus_tag="Amuc_0010"
FT   gene            13898..16282
FT                   /db_xref="GeneID:6275234"
FT                   /locus_tag="Amuc_0011"
FT   CDS_pept        13898..16282
FT                   /locus_tag="Amuc_0011"
FT                   /gene_family="HOG000218459" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /note="KEGG: pth:PTH_2527 NAD-dependent DNA ligase;
FT                   TIGRFAM: DNA ligase, NAD-dependent; PFAM: BRCT domain
FT                   protein; zinc-finger NAD-dependent DNA ligase C4-type;
FT                   NAD-dependent DNA ligase OB-fold; NAD-dependent DNA ligase
FT                   adenylation; SMART: NAD-dependent DNA ligase"
FT                   /db_xref="GI:187734527"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="GeneID:6275234"
FT                   /translation="MEEDLFSLAAGKQPSQQATNETAPRAGEARENAGTDHPGNAEDPA
FT                   HRRIDYLRSELRRHNRLYYEQAEPEISDAEYDALFLELEKLEKAHPELSDPDSPTRRVG
FT                   GAPLQGFNQIRHAVPMLSIDDIFEQRDAPVPDEELAEFYHKLSRALQTENVPVSVEPKI
FT                   DGVALSIMYRNGKLAYAATRGDGDVGDDVTANVRTIRSVPLTLPPGAPPVLEVRGEVFM
FT                   PNEAFAKLNEERDADGLPAFANPRNATAGTLKQLDPRQVAARPLAFLAHGLGAYEGPEL
FT                   RDAKDFWNMLRHCGIPCNEPVYYTDSLESTRQAVRDIDRLRHTLPYGTDGAVIKISSTA
FT                   TREALGATARAPRWAAAYKFPPEQKETTLLNIVVQVGRTGVLTPVAELQPVLLSGSTVA
FT                   RATLHNQDEIDRKDVRIGDTVLVEKAGEIIPAVLKVNLSKRPQDARPYSILEATKGLCP
FT                   ACGNPIMKEEGKVAWRCTNFTCPAQAVTGITHFCSRSALDVESIGSSVAEALRSSGLAS
FT                   SALDLFSLMPDQLANLNLGTPEEPRRYGEKNARKALDALQNARGLPLERWLIAFGIPLV
FT                   GEVVAKALADTHPDLKHVADSPYLRDIVRLDELVEQAAKTNPNTRENKKAVKEGALSAE
FT                   AVQERHQELMEEIDRLTAPYLATGYLRKNTAKFSYGSEIGVAAAKSLRSFFASAAGNHT
FT                   MDVLHRLGINPQSQSYRASLLEIPAGSLSGKTFVITGTLSHPRDYFEQLIASHGGKATG
FT                   AISKSTSCLLAGNGGGSKRDKALKLGVPVISEEDFYKMIGN"
FT                   /transl_table="11"
FT                   /protein_id="YP_001876639.1"
FT   misc_feature    14018..16279
FT                   /note="NAD-dependent DNA ligase LigA; Validated; Region:
FT                   ligA; PRK07956"
FT                   /db_xref="CDD:169167"
FT                   /locus_tag="Amuc_0011"
FT   misc_feature    14036..14983
FT                   /note="NAD+ dependent DNA ligase adenylation domain. DNA
FT                   ligases catalyze the crucial step of joining the breaks in
FT                   duplex DNA during DNA replication, repair and
FT                   recombination, utilizing either ATP or NAD(+) as a
FT                   cofactor, but using the same basic reaction...; Region:
FT                   LIGANc; cd00114"
FT                   /db_xref="CDD:29013"
FT                   /locus_tag="Amuc_0011"
FT   misc_feature    order(14264..14266,14375..14377,14381..14383,14444..14446,
FT                   14552..14554,14708..14710,14894..14896,14900..14902)
FT                   /note="nucleotide binding pocket; other site"
FT                   /db_xref="CDD:29013"
FT                   /locus_tag="Amuc_0011"
FT   misc_feature    order(14381..14383,14387..14392)
FT                   /note="K-X-D-G motif; other site"
FT                   /db_xref="CDD:29013"
FT                   /locus_tag="Amuc_0011"
FT   misc_feature    14381..14383
FT                   /note="catalytic site; other site"
FT                   /db_xref="CDD:29013"
FT                   /locus_tag="Amuc_0011"
FT   misc_feature    14990..15235
FT                   /note="NAD-dependent DNA ligase OB-fold domain; Region:
FT                   DNA_ligase_OB; pfam03120"
FT                   /db_xref="CDD:145978"
FT                   /locus_tag="Amuc_0011"
FT   misc_feature    15266..15343
FT                   /note="NAD-dependent DNA ligase C4 zinc finger domain;
FT                   Region: DNA_ligase_ZBD; pfam03119"
FT                   /db_xref="CDD:145977"
FT                   /locus_tag="Amuc_0011"
FT   misc_feature    16067..16273
FT                   /note="Breast Cancer Suppressor Protein (BRCA1),
FT                   carboxy-terminal domain. The BRCT domain is found within
FT                   many DNA damage repair and cell cycle checkpoint proteins.
FT                   The unique diversity of this domain superfamily allows BRCT
FT                   modules to interact forming homo/...; Region: BRCT;
FT                   cd00027"
FT                   /db_xref="CDD:28909"
FT                   /locus_tag="Amuc_0011"
FT   misc_feature    order(16109..16111,16121..16123,16130..16132,16139..16141,
FT                   16145..16147)
FT                   /note="Dimer interface; other site"
FT                   /db_xref="CDD:28909"
FT                   /locus_tag="Amuc_0011"
FT   misc_feature    order(16256..16258,16268..16270)
FT                   /note="BRCT sequence motif; other site"
FT                   /db_xref="CDD:28909"
FT                   /locus_tag="Amuc_0011"
FT   gene            16460..17068
FT                   /db_xref="GeneID:6275233"
FT                   /locus_tag="Amuc_0012"
FT   CDS_pept        16460..17068
FT                   /locus_tag="Amuc_0012"
FT                   /gene_family="HOG000010898" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CDP-diacylglycerol/glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: CDP-diacylglycerol/glycerol-3-phosphate
FT                   3-phosphatidyltransferase; PFAM: CDP-alcohol
FT                   phosphatidyltransferase; KEGG: bha:BH2386
FT                   phosphatidylglycerophosphate synthase"
FT                   /db_xref="GI:187734528"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="GeneID:6275233"
FT                   /translation="MLNLPNAITLTRIALVVVFTAAVSVADRYSWGYLAALVTFILAAC
FT                   TDWLDGYLARRLNQVTTFGKLIDPLADKIAVSAAFIYLTGEGLCPAWITILIISREFLV
FT                   TGLRQIAQDHGVIIPAGTSGKWKTAFQLAFCIACLLALTWTHTPEYLPSITDRLAALCL
FT                   WHGSGASNLLYQVTLWGSVILTVYSGAVYCAGARKFLQR"
FT                   /protein_id="YP_001876640.1"
FT   sig_peptide     16460..16540
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.871) with cleavage site probability 0.421 at
FT                   residue 27"
FT                   /locus_tag="Amuc_0012"
FT   misc_feature    16466..17035
FT                   /note="CDP-alcohol phosphatidyltransferase; Region:
FT                   CDP-OH_P_transf; cl00453"
FT                   /db_xref="CDD:174212"
FT                   /locus_tag="Amuc_0012"
FT   gene            17172..17333
FT                   /db_xref="GeneID:6275230"
FT                   /locus_tag="Amuc_0013"
FT   CDS_pept        17172..17333
FT                   /locus_tag="Amuc_0013"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:187734529"
FT                   /db_xref="GeneID:6275230"
FT                   /translation="MKECMRNLPLSPFLHMLKPWNVQAVHPLFRKMNASTALKPALPVL
FT                   DIAFRKNI"
FT                   /protein_id="YP_001876641.1"
FT   gene            complement(17295..18533)
FT                   /db_xref="GeneID:6275229"
FT                   /locus_tag="Amuc_0014"
FT   CDS_pept        complement(17295..18533)
FT                   /locus_tag="Amuc_0014"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:187734530"
FT                   /db_xref="GeneID:6275229"
FT                   /translation="MSLKTKVKNGIGIFLVVLSVCCGSPLFAGLQPEEGMDLSKPRIWT
FT                   AVTGHQLKAAYEGRDGNKIRLLANGGKIKTILLEKLSEADQRLLEHLTREENRGGEAGF
FT                   PDSGRNGKEHPFVGFLAEAKQKRLDGEEGVEYYQNLIDALYEEMKKHEFGYPKDFIKED
FT                   GLFNMKYLKSVHGRKKRISERVNLFTGKHLFTPSYGNEPRWEWVDQKINFVIEGDLIRL
FT                   KQQDTLYAKNKEKMVEFGILINKKKRNAENYKAWYTEDSNDYLYRLEACVNSSDDGRFV
FT                   IDRMNREEWLHLCAHDTKKGIFYTLKILVDENGKITIRNSEEGSFLFFATVPKNRGSKD
FT                   VFAYPRNNDRLVFNSVYSIAVALGRYDRNGFLMDLETLWDGVEKRGHYINAKPSGKHDD
FT                   PLNVFAERNVKDR"
FT                   /protein_id="YP_001876642.1"
FT   sig_peptide     complement(18447..18533)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 29"
FT                   /locus_tag="Amuc_0014"
FT   gene            19074..20345
FT                   /db_xref="GeneID:6275227"
FT                   /locus_tag="Amuc_0015"
FT   CDS_pept        19074..20345
FT                   /locus_tag="Amuc_0015"
FT                   /gene_family="HOG000268807" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases; KEGG:
FT                   mag:amb1428 superfamily II DNA and RNA helicase"
FT                   /db_xref="GI:187734531"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="GeneID:6275227"
FT                   /translation="MVSTTFRELGLSAPILRQLENLEYKTPTPIQAACIPLLLQNKDLM
FT                   GLAQTGTGKTAAFALPLIQQLSERSGKPPGRRVRALILSPTRELAAQIHENIRAYARGL
FT                   HLSTAVIFGGVGYASQFKELAGGLDILVATPGRLIDHLERRTVSLDGVETLILDEADHM
FT                   LDMGFAPALKKIVSKIPRKRHTQMFSATMPDNIRQLAQTLLQKPETVRVSPPSSTADRV
FT                   EQFLCMVGSQSEKRLLTLELLKQQELPGRTLIFTRTRHGADRLASFLSGKDYPASAIHG
FT                   DKSQGRRERMLREFRSGKTPVLVATDIAARGIDVKDVRLVINYDLPEEPEVYVHRIGRT
FT                   ARAGAAGQAIALCSPEEIRKARNVHKLLGRLLPVHASSASVPAELRAVPEARRKRSSPM
FT                   QEKRSAPRREPRKGYGRNGSRAEA"
FT                   /protein_id="YP_001876643.1"
FT   misc_feature    19086..20333
FT                   /note="ATP-dependent RNA helicase RhlE; Provisional;
FT                   Region: PRK10590"
FT                   /db_xref="CDD:170554"
FT                   /locus_tag="Amuc_0015"
FT   misc_feature    19089..19706
FT                   /note="DEAD-box helicases. A diverse family of proteins
FT                   involved in ATP-dependent RNA unwinding, needed in a
FT                   variety of cellular processes including splicing, ribosome
FT                   biogenesis and RNA degradation. The name derives from the
FT                   sequence of the Walker  B motif (...; Region: DEADc;
FT                   cd00268"
FT                   /db_xref="CDD:28928"
FT                   /locus_tag="Amuc_0015"
FT   misc_feature    19224..19238
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28928"
FT                   /locus_tag="Amuc_0015"
FT   misc_feature    19545..19556
FT                   /note="Mg++ binding site; other site"
FT                   /db_xref="CDD:28928"
FT                   /locus_tag="Amuc_0015"
FT   misc_feature    19638..19646
FT                   /note="motif III; other site"
FT                   /db_xref="CDD:28928"
FT                   /locus_tag="Amuc_0015"
FT   misc_feature    <19818..20078
FT                   /note="Helicase superfamily c-terminal domain; associated
FT                   with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation
FT                   factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this
FT                   domain is found in a wide variety of helicases and helicase
FT                   related proteins; may...; Region: HELICc; cd00079"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="Amuc_0015"
FT   misc_feature    order(19842..19853,19911..19916,19989..19997)
FT                   /note="nucleotide binding region; other site"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="Amuc_0015"
FT   misc_feature    order(20013..20015,20076..20078)
FT                   /note="ATP-binding site; other site"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="Amuc_0015"
FT   gene            20457..21065
FT                   /db_xref="GeneID:6275225"
FT                   /locus_tag="Amuc_0016"
FT   CDS_pept        20457..21065
FT                   /locus_tag="Amuc_0016"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:187734532"
FT                   /db_xref="GeneID:6275225"
FT                   /translation="MKITSFIIRTLCAGTVGSLACQAAMQAYADDVPSTFVEGNYSPEV
FT                   ARYVQSIAGVALASGIHDYDENATSSYQVLAQVLNSGNVTELPEDLKRAIGMLIGYVPD
FT                   PNEIIQPIMSRKQIERMRKMADRIKNLMEEKYGVDLEDCTNIMKRTLAPSISDILRSCG
FT                   MEGTQLPSTTAFRPRLGKALNEAYARLAAPKLPAAGMAQ"
FT                   /protein_id="YP_001876644.1"
FT   sig_peptide     20457..20546
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.970 at
FT                   residue 30"
FT                   /locus_tag="Amuc_0016"
FT   gene            21561..23006
FT                   /db_xref="GeneID:6275223"
FT                   /locus_tag="Amuc_0017"
FT   CDS_pept        21561..23006
FT                   /locus_tag="Amuc_0017"
FT                   /gene_family="HOG000252553" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="oxidoreductase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   sbm:Shew185_2813 oxidoreductase domain protein"
FT                   /db_xref="GI:187734533"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="GeneID:6275223"
FT                   /translation="MDNSSSRRRFLQTLGLATGALAAGSFANAQEVAPLAPKKITIPDP
FT                   NNIGPMTTWPPRKPGAIYMGGFRAPKLDKVRVAFVGVGERGSMHVGQMAVIEGAEIVGI
FT                   CDLYEDWAKRSADVVEKKTGKRPPIFTKGPEDYKRMMKEVKPDAVIVCPSWEWHCRVTC
FT                   DVMKMGAHAFVEVPMAVSIKELWEIVDTSEETRKHCMMMENVNYGREELMYLNMVRQGV
FT                   IGDLLYGEAAYIHELRGQMKQVERGTGSWRTYHYAKRNGNVYPTHGLGPIAQYMNLARK
FT                   DDCFGRLVSFSSPALGRAAYAKKNFPADHKWNKLDFACGDMNTSIIKTTMGRTVLVEWD
FT                   ETSPRPYSRLNLIQGTLGTLAGFPTRVAGEKLGNGNYHEWIEGKEKLAPIFEKYDHPLW
FT                   KRIGPLALKMGGHGGMDFVMLFRIIECLRNGEPMDQNVYEGAFWSSVSELSEYSVAQGG
FT                   MPQVFPDFTRGDWKTTAPLGIVQ"
FT                   /protein_id="YP_001876645.1"
FT   sig_peptide     21561..21650
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 30"
FT                   /locus_tag="Amuc_0017"
FT   misc_feature    21780..22751
FT                   /note="Predicted dehydrogenases and related proteins
FT                   [General function prediction only]; Region: MviM; COG0673"
FT                   /db_xref="CDD:31017"
FT                   /locus_tag="Amuc_0017"
FT   misc_feature    21783..22163
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="Amuc_0017"
FT   gene            23308..24450
FT                   /db_xref="GeneID:6275222"
FT                   /locus_tag="Amuc_0018"
FT   CDS_pept        23308..24450
FT                   /locus_tag="Amuc_0018"
FT                   /gene_family="HOG000252819" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: nha:Nham_0985 hypothetical protein"
FT                   /db_xref="GI:187734534"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="GeneID:6275222"
FT                   /translation="MLSYCTNIHPAESWAETREALFTCVPRIRQELAAMDSPLKDLPLG
FT                   IGLRLSARAAAELLATPHAAETLKSWLEDQGARVETLNGFPYGNFHGQRVKERVFQPDW
FT                   TTPERFEYTCNLFRILALIGDEQADRLTVSTLPASHSWFHADEERIFSRLDAMSGFLDV
FT                   LGRQTGCLMQLGLEPEPFGHFHDTDGAIRFFNGLRNRSRRPELIERHLGLTYDTCHFAI
FT                   LREEPEFTLSAWEENNIALCKVQFSNALECRICGEEDLERLRQFDDGVYFHQTSILHRE
FT                   GAMLFPDLPNALAYGRDYAEEIRDSQWRIHYHIPLYASPEPPLKSTEEFIQKTHNFLRS
FT                   RKGPQPHLEVETYTWSVLPDHMKIPLAAQIARELHYIETL"
FT                   /protein_id="YP_001876646.1"
FT   misc_feature    23926..>24447
FT                   /note="DNA polymerase III, alpha subunit [DNA replication,
FT                   recombination, and repair]; Region: DnaE; COG0587"
FT                   /db_xref="CDD:30932"
FT                   /locus_tag="Amuc_0018"
FT   gene            24455..25414
FT                   /db_xref="GeneID:6275220"
FT                   /locus_tag="Amuc_0019"
FT   CDS_pept        24455..25414
FT                   /locus_tag="Amuc_0019"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: gur:Gura_1976 peptidase M28"
FT                   /db_xref="GI:187734535"
FT                   /db_xref="GeneID:6275220"
FT                   /translation="MMPRMHPSAFLSSGFLLLSTGLSSCTFLPMFSSGGQETPRTLGAR
FT                   MEKHTEVLQKDIGERNASQPKSMEAAAKYIAGNFSDMGYAVTMQPVSGGNVKKGAAIYN
FT                   ILVYKPGLYSNNQSIVVGANYDSSGQRNNGSGTALLLETARGLKDIPTNHNIYFVAYAN
FT                   GAEPAGKSISSGACVHASTLSGSIGATNILGMINLEPQKLDAGGERKQPGPESSREAVL
FT                   FTTTPHGKKFAGQCAAPFAKSWEQAPATFHREPSALTGNDRHYAVLGIPTVSCRSKYPV
FT                   TDARTEEYVQALTDMIHQVADNDAPEPAKNAGQGEKAS"
FT                   /protein_id="YP_001876647.1"
FT   sig_peptide     24455..24562
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.795 at
FT                   residue 36"
FT                   /locus_tag="Amuc_0019"
FT   misc_feature    24803..25273
FT                   /note="Peptidase dimerization domain; Region: M20_dimer;
FT                   cl09126"
FT                   /db_xref="CDD:175013"
FT                   /locus_tag="Amuc_0019"
FT   gene            complement(25433..26587)
FT                   /db_xref="GeneID:6275218"
FT                   /locus_tag="Amuc_0020"
FT   CDS_pept        complement(25433..26587)
FT                   /locus_tag="Amuc_0020"
FT                   /gene_family="HOG000280030" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative MFS family transporter protein"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ypi:YpsIP31758_2592 transporter, major facilitator family"
FT                   /db_xref="GI:187734536"
FT                   /db_xref="InterPro:IPR007114"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:6275218"
FT                   /translation="MRTFTWPIALLLAGLLFQTVAFAVLNTVVPLWMEQFDAATWEAGL
FT                   VGAFFFLGNLAGTLLAGGVIRRAGFKGSYQYACLLCAVSTVLLPVFPGVPAWSGLRLLA
FT                   GISCALVWVVVESALLRAGTLQTRGILLASYMVVYYLGTVLGQLLLGWFPSDMPLIVTE
FT                   VCILSVAGMVPLMFARLEPGNGQVSSSSHIEIRTLLRRRSVFLGVVGCVISGVVLGTIY
FT                   CLMPLFLKHQGMDHSSVGYWMALLIAAAILGQWPMGRLADRYGRAFVMKCQSLLVAAAC
FT                   AGLMLKGGLMAPSLIALGLAGFSLYPVAMAWGCEEASRDELVTMNQLLLLSYSLGTLAG
FT                   PSLTSFLMQRYSDNWMPMVIALVALSFMPVLMLGGGHGRRKLSR"
FT                   /protein_id="YP_001876648.1"
FT   misc_feature    complement(25436..26587)
FT                   /note="putative MFS family transporter protein;
FT                   Provisional; Region: PRK03633"
FT                   /db_xref="CDD:167566"
FT                   /locus_tag="Amuc_0020"
FT   sig_peptide     complement(26516..26587)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 24"
FT                   /locus_tag="Amuc_0020"
FT   misc_feature    complement(25469..26566)
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Amuc_0020"
FT   misc_feature    complement(order(25577..25579,25586..25591,25598..25603,
FT                   25610..25615,25646..25648,25655..25660,25670..25672,
FT                   25673..25675,25682..25684,25826..25828,25838..25840,
FT                   25847..25849,25859..25861,25871..25873,25913..25915,
FT                   25922..25927,25934..25939,25946..25948,26159..26161,
FT                   26177..26182,26189..26194,26228..26230,26237..26242,
FT                   26249..26254,26261..26266,26402..26407,26411..26416,
FT                   26426..26428,26435..26440,26447..26449,26498..26503,
FT                   26507..26515,26522..26524))
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Amuc_0020"
FT   gene            complement(26737..28134)
FT                   /db_xref="GeneID:6275215"
FT                   /locus_tag="Amuc_0021"
FT   CDS_pept        complement(26737..28134)
FT                   /locus_tag="Amuc_0021"
FT                   /gene_family="HOG000071905" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 factor; sigma-54 factor core-binding region;
FT                   sigma-54 DNA-binding domain protein; KEGG: ent:Ent638_3638
FT                   RNA polymerase factor sigma-54"
FT                   /db_xref="GI:187734537"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="GeneID:6275215"
FT                   /translation="MSEVSLQHGMTRQMAVSQSMQTGMQILQASALELRQIIRQALETN
FT                   PMLEELPDASPEALEDGPDGDAWNEREDGWNEFTAEGRLSGDAAARRDFMYESVVAPES
FT                   LKTHLMDQAQHSALTGRARDALFLLIDALDERGFLTESPQELEEQGCFSMRDMEEALAA
FT                   LREMDPPGVGAANLRDSLLIQLEQRGLKRSLAFRLVKRCWRELAAHKYEEAARLLDVEP
FT                   GAVAAALEVIRSLTPDPGGAYAPGGNPHLLPDVIVEEGPSGVLEVILTSEYLPRLSMNE
FT                   RYMELMAEGSGSRELRQYLRRAFREGQELLRALDMRQETVLRLARVIVRRQEDFFRSGP
FT                   SRLKAMGMEEVAEEMGVHVSTVSRACRDKYLLCRWGMKELRSFFSAGVPSEGGVSPDGA
FT                   ASGAVAAGAVQELMRRLIAEEDSSKPLSDAGLAAALREKGVNIARRTVAKYREQMKILP
FT                   ASLRRGI"
FT                   /protein_id="YP_001876649.1"
FT   misc_feature    complement(26746..28122)
FT                   /note="RNA polymerase factor sigma-54; Reviewed; Region:
FT                   PRK05932"
FT                   /db_xref="CDD:168298"
FT                   /locus_tag="Amuc_0021"
FT   misc_feature    complement(27985..28122)
FT                   /note="Sigma-54 factor, Activator interacting domain (AID);
FT                   Region: Sigma54_AID; pfam00309"
FT                   /db_xref="CDD:144047"
FT                   /locus_tag="Amuc_0021"
FT   misc_feature    complement(27286..27834)
FT                   /note="Sigma-54 factor, core binding domain; Region:
FT                   Sigma54_CBD; pfam04963"
FT                   /db_xref="CDD:147239"
FT                   /locus_tag="Amuc_0021"
FT   misc_feature    complement(26746..27246)
FT                   /note="Sigma-54, DNA binding domain; Region: Sigma54_DBD;
FT                   pfam04552"
FT                   /db_xref="CDD:113327"
FT                   /locus_tag="Amuc_0021"
FT   gene            28275..28985
FT                   /db_xref="GeneID:6275213"
FT                   /locus_tag="Amuc_0022"
FT   CDS_pept        28275..28985
FT                   /locus_tag="Amuc_0022"
FT                   /gene_family="HOG000275643" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /transl_table="11"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   sde:Sde_2497 TonB-like"
FT                   /db_xref="GI:187734538"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="GeneID:6275213"
FT                   /translation="MKILHILAFSLLASLLSTAAPSPLTPLPREQPQWWRKQYEQQVEQ
FT                   IKNNPCGVLFLGDSITDYWKREGKPIWEKAFSPYHPCNFGISGDQTTNLIYRITDSGIP
FT                   AQTDPKLCIVMIGTNNTGHFKGGEAPEKTAMGILGAVEHLLVRFPDTHVLLLGIFPRGT
FT                   GPQDKLRQHNDRINAILAQCKLPRTTYANINRRFLDSSGKLLPGISRDNLHFTEKGYAI
FT                   WADAVLPYIKKYCK"
FT                   /protein_id="YP_001876650.1"
FT   sig_peptide     28275..28334
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT                   /locus_tag="Amuc_0022"
FT   misc_feature    28362..28973
FT                   /note="SGNH_hydrolase, or GDSL_hydrolase, is a diverse
FT                   family of lipases and esterases. The tertiary fold of the
FT                   enzyme is substantially different from that of the
FT                   alpha/beta hydrolase family and unique among all known
FT                   hydrolases; its active site closely...; Region:
FT                   SGNH_hydrolase; cl01053"
FT                   /db_xref="CDD:174507"
FT                   /locus_tag="Amuc_0022"
FT   misc_feature    order(28449..28451,28536..28538,28629..28631,28905..28907,
FT                   28914..28916)
FT                   /note="active site"
FT                   /db_xref="CDD:58496"
FT                   /locus_tag="Amuc_0022"
FT   misc_feature    order(28449..28451,28905..28907,28914..28916)
FT                   /note="catalytic triad; other site"
FT                   /db_xref="CDD:58496"
FT                   /locus_tag="Amuc_0022"
FT   misc_feature    order(28449..28451,28536..28538,28629..28631)
FT                   /note="oxyanion hole; other site"
FT                   /db_xref="CDD:58496"
FT                   /locus_tag="Amuc_0022"
FT   gene            29374..30150
FT                   /db_xref="GeneID:6275211"
FT                   /locus_tag="Amuc_0023"
FT   CDS_pept        29374..30150
FT                   /locus_tag="Amuc_0023"
FT                   /gene_family="HOG000251510" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phenazine biosynthesis protein PhzF family"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: phenazine biosynthesis protein PhzF family;
FT                   PFAM: Phenazine biosynthesis PhzC/PhzF protein; KEGG:
FT                   cbb:CLD_2590 phenazine biosynthesis protein, PhzF family"
FT                   /db_xref="GI:187734539"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="GeneID:6275211"
FT                   /translation="MKQYIIDAFTDKVFHGNPTAICILEQWPSGELMLNMAVENNLSET
FT                   AFAVKKGGSYHLRWFTPGGEIDLCGHATLACAYVILNFYEKEAAKVVFQTLSGDLVVER
FT                   HGDLYEMDFPAYELKPVPVTEQMIDAIGATPREAYMGRDLLCVFDDIKIIEHLNPDLSK
FT                   VHALNGLLLHVTAKGTETDCVSRTFAPKCGVPEDAVCGSGHCHIIPYWANRLGKDDIIA
FT                   YQASKRGGTLYCRMDGARVKLAGKAALYSIAETQSR"
FT                   /protein_id="YP_001876651.1"
FT   misc_feature    29383..>29976
FT                   /note="hypothetical protein; Provisional; Region: PRK10281"
FT                   /db_xref="CDD:170349"
FT                   /locus_tag="Amuc_0023"
FT   misc_feature    29389..30117
FT                   /note="Phenazine biosynthesis-like protein; Region:
FT                   PhzC-PhzF; pfam02567"
FT                   /db_xref="CDD:145612"
FT                   /locus_tag="Amuc_0023"
FT   gene            30657..31256
FT                   /db_xref="GeneID:6275209"
FT                   /locus_tag="Amuc_0024"
FT   CDS_pept        30657..31256
FT                   /locus_tag="Amuc_0024"
FT                   /gene_family="HOG000238852" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF204"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF204; KEGG:
FT                   dvl:Dvul_0455 protein of unknown function DUF204"
FT                   /db_xref="GI:187734540"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="GeneID:6275209"
FT                   /translation="MSMPLADLIFLAFALSVDAFVVAFSYGLLIKQKRLSNGIKLSLST
FT                   GAGQFLMPVLGFLLTGSVHRYIAAWDHWLGFAVFTFLGVNVLREGWNHRNEEEDMPHVT
FT                   SLTFPTLMAVGIATSIDALVAGISIYLSSAQCGTDPTLHAVLLPAAAIGFTTFLCTAAG
FT                   FFLTRRLHRFPTFHLEAGAGLILIGLGVKMLCDHLC"
FT                   /protein_id="YP_001876652.1"
FT   misc_feature    30663..31175
FT                   /note="Predicted membrane protein [Function unknown];
FT                   Region: COG1971"
FT                   /db_xref="CDD:32154"
FT                   /locus_tag="Amuc_0024"
FT   misc_feature    30699..30905
FT                   /note="Domain of unknown function DUF; Region: DUF204;
FT                   pfam02659"
FT                   /db_xref="CDD:145682"
FT                   /locus_tag="Amuc_0024"
FT   gene            31260..33593
FT                   /db_xref="GeneID:6275207"
FT                   /locus_tag="Amuc_0025"
FT   CDS_pept        31260..33593
FT                   /locus_tag="Amuc_0025"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; KEGG:
FT                   rba:RB12351 similar to C-type cytochrome"
FT                   /db_xref="GI:187734541"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="GeneID:6275207"
FT                   /translation="MPRRMIKTSFWHRNKSKNALVPSHLFLLLSSNPFHMNISHLLLCT
FT                   SLLAAPVCAAQGLTETETETPASSSRLPAPLAQKIASGDFDGLQTELRSTLLKAGEQTK
FT                   SEQKLLQNKQYRHLLDIHELLRVTGPDKVKAVFSKSAQDAAFIKTFLQDPVWMELYLGA
FT                   GLIPENSPEGLQILSDIWKADGKSPDFRNYQSLATGLASVFSTGPMAGRLKTNSANSNP
FT                   VRRYRIFKKLHQENRLHPGFIKLRPWEMRFVVGSPWDDKSYEWSNEHVNLPWRRYTAAC
FT                   WAAPYTGHNFFGDTIQGPLFYVPWRDLNTTAENTQIIGGVCGGLSYFGTMAAQAHGIPA
FT                   YPVGQPGHCAYAVRVKRGEWKGGFGGPDGGMHNHIFGSQAPTSYLLMENVFADNDKADQ
FT                   AYLWAAQARLDEASGNKDKAIQAWEEALRQTPLHPFFRTELQRLLMEKEGMQPVDWYVY
FT                   AKDALSHYQGNGFAAFDILKDVQNKFLMDIPPADRIAWFRDLHEAIATTPTSWAVKFQP
FT                   VLDSQSAFLANPQEKAAYLETVLSTHLKTGDGTNFGQALEWGVKNFVENGQADVFSNAF
FT                   AKVAQQTGKTGTSGKAPDPKKLKEAYGKAIYATETARSIPAFQALSKAAASFSGANATN
FT                   NTVKASIPQGWKLVPADGMVRCSTTSQWDSPWDHINLLRPCGGAQHTDKEANPNVIVEL
FT                   KNGVNLAGLVVTKRDGNENRMKKMEVSTSTDGATWFPLAATENMPKEWVITAPEGTKAK
FT                   WIKVEAKNAQPEFMHLRHILVYEK"
FT                   /protein_id="YP_001876653.1"
FT   sig_peptide     31260..31427
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.570 at
FT                   residue 56"
FT                   /locus_tag="Amuc_0025"
FT   misc_feature    <33303..33554
FT                   /note="Coagulation factor 5/8 C-terminal domain, discoidin
FT                   domain; Cell surface-attached carbohydrate-binding domain,
FT                   present in eukaryotes and assumed to have horizontally
FT                   transferred to eubacterial genomes; Region: FA58C; cl12042"
FT                   /db_xref="CDD:176621"
FT                   /locus_tag="Amuc_0025"
FT   gene            33610..34827
FT                   /db_xref="GeneID:6275205"
FT                   /locus_tag="Amuc_0026"
FT   CDS_pept        33610..34827
FT                   /locus_tag="Amuc_0026"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:187734542"
FT                   /db_xref="GeneID:6275205"
FT                   /translation="MLHHINPVSGLLAAALFLSAPVQAALPVYSAVKDEAKTVNKYMIV
FT                   VWAGTDWSPKSREITRAVEHLAKNSPEPVLWCIQDEREEMTEEEQKLPKPPGEIWNIPA
FT                   IQVVSPTGNMVFLSEGVSRETLPAVMKQAMEAVKQQNKANALWEKAAASSGTAAALLYG
FT                   EGLQQLPPYAASSRKDILEKIKKADPEDIKGVHFKYTFRHLPYIEKVQRMVNDSAKDGG
FT                   PKDYKTAHAYVNKQLKTPGLTPLQKQQVMAARFWLYRNEGKKDQALKTLTDIARISPKT
FT                   LMGIGAQNYYRYLTEPVTLKSPHFTGYDLRPELTPTRVNVSSMLDGPGNYKITFKMNSG
FT                   GCNIRNPRFMKGNRVVSELPKDRQDKNGREFTLRLSGSEKPDLVFDCQGQGWFDADCDI
FT                   IVTKES"
FT                   /protein_id="YP_001876654.1"
FT   sig_peptide     33610..33684
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT                   /locus_tag="Amuc_0026"
FT   gene            complement(35058..36437)
FT                   /db_xref="GeneID:6275198"
FT                   /locus_tag="Amuc_0027"
FT   CDS_pept        complement(35058..36437)
FT                   /locus_tag="Amuc_0027"
FT                   /gene_family="HOG000017623" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="AAA ATPase central domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: magnesium chelatase ChlI subunit; AAA ATPase
FT                   central domain protein; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase; KEGG:
FT                   dau:Daud_2041 AAA ATPase, central domain protein"
FT                   /db_xref="GI:187734543"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="GeneID:6275198"
FT                   /translation="MDLFSLQEEEAREGFEPGADTSAMPLAARMRPRTLDEVAGQKHLL
FT                   APGKLLRRAIETDRFTSLIFYGPPGCGKTTLAAVIARTTNAHFMMLNGVESNVADIREK
FT                   IAQAQMRMSMHGRKTVLFVDELHRFNKAQQDVLLPHLEKGTVRFIGATTENPYFAINSP
FT                   LLSRSQVFPMEPVPEEELAALLKRALADEVRGLGASRVDMEAEALNHLAAKADGDARKA
FT                   LTALEVAVLSTPAGKDGVIHVDISVAEESIQRKAIRYDRLGDSHYDTISAFIKSMRGSD
FT                   PDAALYWLGMMLEAGEDIRFIGRRLVIAASEDVGLADSNALRVALDAARAAEMVGMPEA
FT                   RIPLAHAAVYLATAPKSNSAYMGINAAMDDVRNGKTLAVPEHLRTPTRKKLAAAGGADA
FT                   ARLEYLYSHDYPEHYVPQAYLPEGRVYYTPTGNGLELRIRERMEYRRQLAENAGEGGKK
FT                   G"
FT                   /protein_id="YP_001876655.1"
FT   misc_feature    complement(35097..36383)
FT                   /note="recombination factor protein RarA; Reviewed; Region:
FT                   PRK13342"
FT                   /db_xref="CDD:171990"
FT                   /locus_tag="Amuc_0027"
FT   misc_feature    complement(35937..36293)
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Amuc_0027"
FT   misc_feature    complement(36216..36239)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Amuc_0027"
FT   misc_feature    complement(order(35979..35981,36066..36068,36213..36236))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Amuc_0027"
FT   misc_feature    complement(36063..36080)
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Amuc_0027"
FT   misc_feature    complement(35937..35939)
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Amuc_0027"
FT   misc_feature    complement(35097..35603)
FT                   /note="MgsA AAA+ ATPase C terminal; Region: MgsA_C;
FT                   cl13440"
FT                   /db_xref="CDD:175421"
FT                   /locus_tag="Amuc_0027"
FT   gene            complement(36545..36940)
FT                   /db_xref="GeneID:6275196"
FT                   /locus_tag="Amuc_0028"
FT   CDS_pept        complement(36545..36940)
FT                   /locus_tag="Amuc_0028"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mkm:Mkms_5375 amino acid permease-associated
FT                   region"
FT                   /db_xref="GI:187734544"
FT                   /db_xref="GeneID:6275196"
FT                   /translation="MYFFRDSSAKQLPAFKDPCFELAMARRKEEARWGWIPFAIFVFFL
FT                   LVYRFFGLVMPSNNADGSQSWLFLLVLAGWGLLALVHMVVVPIWMLIASLHYWEVNRRG
FT                   LAVAGLLFSILAPVSMVFMLSCWSMFG"
FT                   /protein_id="YP_001876656.1"
FT   gene            complement(37306..38232)
FT                   /db_xref="GeneID:6275193"
FT                   /locus_tag="Amuc_0029"
FT   CDS_pept        complement(37306..38232)
FT                   /locus_tag="Amuc_0029"
FT                   /gene_family="HOG000167994" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /transl_table="11"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; Male sterility domain; KEGG: mba:Mbar_A1144
FT                   dTDP-glucose 4,6-dehydratase"
FT                   /db_xref="GI:187734545"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR002225"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="GeneID:6275193"
FT                   /translation="MKILVTGGAGFIGSHIVEHYQDKAEEIRVLDNLRTGYLKNLEGLR
FT                   HTFIEGSICDRELVRQAVQGVDYIFHMAALVSVPESMSKISECIDINVNGLLNVLEEAS
FT                   AAGVKKIVLASSAAIYGDNPTVPKLETMYPEPKSPYAITKLDGEYYLNMFRAEGKINTA
FT                   AVRFFNVFGPRQDPKGAYAAAVPIFIEKAVKGEDITVYGDGSQTRDFIYVKDIVGALTF
FT                   VAEHPEVTGVFNAGYGGQITIEELAQNIIKAAGSSSKVLHAPERPGDVKHSRACADKLR
FT                   NAGWQPRHTLPEGLATTLEYFKGILGR"
FT                   /protein_id="YP_001876657.1"
FT   misc_feature    complement(37324..38232)
FT                   /note="Nucleoside-diphosphate-sugar epimerases [Cell
FT                   envelope biogenesis, outer membrane / Carbohydrate
FT                   transport and metabolism]; Region: WcaG; COG0451"
FT                   /db_xref="CDD:30800"
FT                   /locus_tag="Amuc_0029"
FT   misc_feature    complement(<37735..38220)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="Amuc_0029"
FT   misc_feature    complement(37309..>37938)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="Amuc_0029"
FT   gene            complement(38259..39353)
FT                   /db_xref="GeneID:6275189"
FT                   /locus_tag="Amuc_0030"
FT   CDS_pept        complement(38259..39353)
FT                   /locus_tag="Amuc_0030"
FT                   /gene_family="HOG000001225" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cpe:CPE1200 hypothetical protein"
FT                   /db_xref="GI:187734546"
FT                   /db_xref="GeneID:6275189"
FT                   /translation="MHDLKAVSTLFDLRGDFVHGYSYGSGHINDTYCIWVDQAGQRIRY
FT                   ILQRVNHNVFKQPIPLMENVKRVTDHALKRLKEEQCPEAYRRTLTLVPSVDGKPYALDS
FT                   DGNCWRVYPFIERARTYDQIETTRQCQEAARAFGEFQKLTADLPGEPLFETIPNFHNTT
FT                   SRLAALKEAIQSDPLGRVKEVQKEIDWYLSRESDCHLVVDYLKSGELPLRCTHNDTKLN
FT                   NVMLDDVTGEGICVIDLDTTMPGSAIYDFGDMIRTATSPAAEDEKDVSKVTMRMFMFEA
FT                   LVQGYLSSAKSFLTPLEKSLLPFSGKLLTMECGIRFLTDYLSGDVYFKIHRPEHNLDRC
FT                   RTQMALVESIEAQMDEMKAIVDRY"
FT                   /protein_id="YP_001876658.1"
FT   misc_feature    complement(<39201..39344)
FT                   /note="Catalytic domain of phosphoinositide-specific
FT                   phospholipase C-like phosphodiesterases superfamily;
FT                   Region: PI-PLCc_GDPD_SF; cl14615"
FT                   /db_xref="CDD:176625"
FT                   /locus_tag="Amuc_0030"
FT   misc_feature    complement(39273..39275)
FT                   /note="catalytic site; other site"
FT                   /db_xref="CDD:176498"
FT                   /locus_tag="Amuc_0030"
FT   misc_feature    complement(<38640..39056)
FT                   /note="Protein Kinases, catalytic domain; Region: PKc_like;
FT                   cl09925"
FT                   /db_xref="CDD:175044"
FT                   /locus_tag="Amuc_0030"
FT   gene            complement(39366..40241)
FT                   /db_xref="GeneID:6275187"
FT                   /locus_tag="Amuc_0031"
FT   CDS_pept        complement(39366..40241)
FT                   /locus_tag="Amuc_0031"
FT                   /gene_family="HOG000001237" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pgi:PG0160 hypothetical protein"
FT                   /db_xref="GI:187734547"
FT                   /db_xref="GeneID:6275187"
FT                   /translation="MGSRYGGLKQLDPMGPNGEVVLDYSVYDAIRAGFGKVVFIIRRDF
FT                   EDIFKEKVGSRFAGKIEVDYAFQSLDDLPEGFSVPEGREKPWGTAHALRAARHVVKEPF
FT                   AVVNADDFYGADAFVQAAKFLTSTTDEPGKAHYGMIGYPLKNTLSDNGDVNRGICSIKG
FT                   GLLDGVEEFVKIQADEDGVVRGNNLKGERLPVDPAELVSMNFWLFSPSFIELTEDHFID
FT                   FLKEHGQEPKSECFIPTVVDALIHADRADCAVLPTSSSWFGMTYPGDKPMVVEGINKLI
FT                   QQGVYPEKLN"
FT                   /protein_id="YP_001876659.1"
FT   misc_feature    complement(<39609..40205)
FT                   /note="Nucleoside-diphosphate-sugar pyrophosphorylase
FT                   involved in lipopolysaccharide biosynthesis/translation
FT                   initiation factor 2B, gamma/epsilon subunits
FT                   (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis,
FT                   outer membrane / Translation, ribosomal structure...;
FT                   Region: GCD1; COG1208"
FT                   /db_xref="CDD:31401"
FT                   /locus_tag="Amuc_0031"
FT   misc_feature    complement(<39894..40181)
FT                   /note="Glycosyltransferase family A (GT-A) includes diverse
FT                   families of glycosyl transferases with a common GT-A type
FT                   structural fold; Region: Glyco_tranf_GTA_type; cl11394"
FT                   /db_xref="CDD:176938"
FT                   /locus_tag="Amuc_0031"
FT   misc_feature    complement(order(39912..39914,39918..39920,40122..40124))
FT                   /note="active site"
FT                   /db_xref="CDD:132997"
FT                   /locus_tag="Amuc_0031"
FT   gene            complement(40350..41069)
FT                   /db_xref="GeneID:6275184"
FT                   /locus_tag="Amuc_0032"
FT   CDS_pept        complement(40350..41069)
FT                   /locus_tag="Amuc_0032"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:187734548"
FT                   /db_xref="GeneID:6275184"
FT                   /translation="MRLFSIILCCAVQAVLGYDGPPPLTEVDGRSPIRMGGEMLGGYRS
FT                   YYVHRGEKMGADSTEGQISGGASLSDSWAVSGELFAIRNWQGRHFSQATLHGEVQYYLA
FT                   DECTAGLFVNGQWYDSCPLKNGAEPGLSLKWNPTPSWSFRGSFLYDSGQEGAYSQWGVT
FT                   WQPLLCESVAMVNTVSLGFAHDYLGRNGLKELMVRTGALWAVSGGLRVEPFLGWYCGYG
FT                   RDDFKKVVLGLWCSYVF"
FT                   /protein_id="YP_001876660.1"
FT   sig_peptide     complement(41016..41069)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.729) with cleavage site probability 0.705 at
FT                   residue 18"
FT                   /locus_tag="Amuc_0032"
FT   gene            41173..41865
FT                   /db_xref="GeneID:6275181"
FT                   /locus_tag="Amuc_0033"
FT   CDS_pept        41173..41865
FT                   /locus_tag="Amuc_0033"
FT                   /gene_family="HOG000062008" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="peptidase M50"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidase M50; KEGG: pcu:pc1296 hypothetical
FT                   protein"
FT                   /db_xref="GI:187734549"
FT                   /db_xref="InterPro:IPR006025"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="GeneID:6275181"
FT                   /translation="MVHFTLFGIPVYIRPSFWVVLAIFGGALSISSVEDLIYPALFVIA
FT                   GFIAILSHEMGHALVGRKLGGGQQTIVLELFGGLTSSHGMQLTRGGRALMILAGPMMTL
FT                   LLGIISLWLTWNIVAPVMASYNLNFWDLAISPFTAALISPKLYILSCLIMIGEWWTILN
FT                   LLPIYPLDGGQLIAQYIRSPRKVFMTGFITAILIGLLSFQLFHGYFIPIFMALFAYSNY
FT                   REYKNAPF"
FT                   /protein_id="YP_001876661.1"
FT   misc_feature    41182..41835
FT                   /note="Site-2 protease (S2P) class of zinc metalloproteases
FT                   (MEROPS family M50) cleaves transmembrane domains of
FT                   substrate proteins, regulating intramembrane proteolysis
FT                   (RIP) of diverse signal transduction mechanisms. Members of
FT                   this family use proteolytic...; Region: S2P-M50; cl10020"
FT                   /db_xref="CDD:127338"
FT                   /locus_tag="Amuc_0033"
FT   misc_feature    order(41329..41334,41341..41343,41659..41661,41683..41685)
FT                   /note="active site"
FT                   /db_xref="CDD:100078"
FT                   /locus_tag="Amuc_0033"
FT   misc_feature    41659..41670
FT                   /note="putative substrate binding region; other site"
FT                   /db_xref="CDD:100078"
FT                   /locus_tag="Amuc_0033"
FT   gene            41923..43443
FT                   /db_xref="GeneID:6275179"
FT                   /locus_tag="Amuc_0034"
FT   CDS_pept        41923..43443
FT                   /locus_tag="Amuc_0034"
FT                   /gene_family="HOG000167538" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="KEGG: ade:Adeh_0024 prolyl-tRNA synthetase; TIGRFAM:
FT                   prolyl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Anticodon-binding domain protein; Prolyl-tRNA
FT                   synthetase, class II-like"
FT                   /db_xref="GI:187734550"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="GeneID:6275179"
FT                   /translation="MSQQTAITPTRAQDFPEWYQQVIKAADMAENSEVRGCMVIKPWGY
FT                   AIWELIQKDLDQRFKDTGHTNAYFPLLIPISYLEKEAEHAEGFATECAVVTHHRLEAQK
FT                   DEATGKTRMIPTGELTEPFVIRPTSETVIGAAFARWTSSYRDLPLKVNQWCNVMRWEMR
FT                   PRIFLRTAEFLWQEGHTAHETREEAIEETLTMHKVYEEFQRDVLAIPTIPGEKTEAERF
FT                   PGAEQTYTVEAMVQDRKAIQAGTSHFLGQNFSKSQNICFAGRDNTQQFAWTSSWGVSTR
FT                   MIGALIMMHSDDDGLVCPPRVAPQQIVIIPVTPKEESRQAVLDHCEELARTLRAKTFHG
FT                   QPLRVLVDRRDLGGGAKKWEWVKKGVPVRLEIGPRDLEKGSVCLQRRDRPANEKSFVPE
FT                   TELIDTAADILQSIQDTLLQRAIAFRDSHIRPASTLRELEENFSGEGDADWLQVPWDGS
FT                   PEEEEELAKRLRISIRCIPLGELGRGEPAPCILTGRMTKRRVLWARSY"
FT                   /transl_table="11"
FT                   /protein_id="YP_001876662.1"
FT   misc_feature    41923..43440
FT                   /note="prolyl-tRNA synthetase; Provisional; Region:
FT                   PRK08661"
FT                   /db_xref="CDD:169544"
FT                   /locus_tag="Amuc_0034"
FT   misc_feature    41962..42789
FT                   /note="Prolyl-tRNA synthetase (ProRS) class II core
FT                   catalytic domain. ProRS is a homodimer. It is responsible
FT                   for the attachment of proline to the 3' OH group of ribose
FT                   of the appropriate tRNA. This domain is primarily
FT                   responsible for ATP-dependent formation...; Region:
FT                   ProRS_core_arch_euk; cd00778"
FT                   /db_xref="CDD:29823"
FT                   /locus_tag="Amuc_0034"
FT   misc_feature    order(42010..42015,42037..42048,42067..42069,42118..42126,
FT                   42130..42135,42196..42198,42202..42216,42328..42330,
FT                   42388..42390,42436..42438)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29823"
FT                   /locus_tag="Amuc_0034"
FT   misc_feature    42112..42135
FT                   /note="motif 1; other site"
FT                   /db_xref="CDD:29823"
FT                   /locus_tag="Amuc_0034"
FT   misc_feature    order(42304..42306,42310..42312,42397..42399,42403..42405,
FT                   42424..42432,42439..42441,42445..42447,42451..42453,
FT                   42646..42648,42652..42657,42661..42663,42745..42753,
FT                   42757..42759,42763..42765)
FT                   /note="active site"
FT                   /db_xref="CDD:29823"
FT                   /locus_tag="Amuc_0034"
FT   misc_feature    42394..42405
FT                   /note="motif 2; other site"
FT                   /db_xref="CDD:29823"
FT                   /locus_tag="Amuc_0034"
FT   misc_feature    42751..42765
FT                   /note="motif 3; other site"
FT                   /db_xref="CDD:29823"
FT                   /locus_tag="Amuc_0034"
FT   misc_feature    42805..43440
FT                   /note="ProRS Prolyl-anticodon binding domain, long version
FT                   found predominantly in eukaryotes and archaea. ProRS
FT                   belongs to class II aminoacyl-tRNA synthetases (aaRS). This
FT                   alignment contains the anticodon binding domain, which is
FT                   responsible for specificity...; Region:
FT                   ProRS_anticodon_zinc; cd00862"
FT                   /db_xref="CDD:29802"
FT                   /locus_tag="Amuc_0034"
FT   misc_feature    order(42856..42861,42997..42999,43015..43017,43039..43041,
FT                   43069..43071,43075..43077)
FT                   /note="anticodon binding site; other site"
FT                   /db_xref="CDD:29802"
FT                   /locus_tag="Amuc_0034"
FT   misc_feature    order(43288..43290,43303..43305,43387..43389,43396..43398)
FT                   /note="zinc-binding site; other site"
FT                   /db_xref="CDD:29802"
FT                   /locus_tag="Amuc_0034"
FT   gene            43727..43801
FT                   /note="tRNA-Gly1"
FT                   /db_xref="GeneID:6275176"
FT                   /locus_tag="Amuc_R0002"
FT   tRNA            43727..43801
FT                   /db_xref="GeneID:6275176"
FT                   /locus_tag="Amuc_R0002"
FT                   /product="tRNA-Gly"
FT   gene            complement(44582..44995)
FT                   /db_xref="GeneID:6275174"
FT                   /locus_tag="Amuc_0035"
FT   CDS_pept        complement(44582..44995)
FT                   /locus_tag="Amuc_0035"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:187734551"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="GeneID:6275174"
FT                   /translation="MKKKIWIVIGIATLYFIYLPFSLFWSGIDKGNGMERSVTLLKTVK
FT                   KDLELHKIFARHGMKLTGDGASWRGKTCEIWFVVEDGTNARIPPEVEEYLLNNPDLVKG
FT                   CRIEVQIKIPPESKEEPYRVCCEKIYFPWRLFY"
FT                   /protein_id="YP_001876663.1"
FT   gene            complement(45594..51467)
FT                   /db_xref="GeneID:6275170"
FT                   /locus_tag="Amuc_0036"
FT   CDS_pept        complement(45594..51467)
FT                   /locus_tag="Amuc_0036"
FT                   /gene_family="HOG000062009" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="YD repeat protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: YD repeat protein; PFAM: YD
FT                   repeat-containing protein; KEGG: dol:Dole_2050 YD repeat
FT                   protein"
FT                   /db_xref="GI:187734552"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="GeneID:6275170"
FT                   /translation="MKKRQFQHHVDSLPDNALTVSGGGPAPFDKEAGAFSGSWDWGIIV
FT                   DPLGPGETAECRLMLGVDDNGTLTVDGEGIFIPGEGKYHGGTYREKSLSFPIEPGPHRV
FT                   HMTYENVAVPPEWTNLAILNYSIEVMVSDGTSSSSYQPDEGYPEPVSTEDEGEDVPCEC
FT                   GGDGNGSQSSSSSPCPEEDNGEGDNGEDEAPCTCENNEGGSSSSSAHGVRGSSTLYGSS
FT                   AAGRRVVARTLKTEMVWRTNFGSFRGMTGLPQGLLDIVGYTFSSELWSPRALHYWHPMT
FT                   HEIISAPLSGIGANTAFQIRSGGTDINYYCYADGGGSGVDSVAPIAGSAKRGGSAWFGR
FT                   RSASSAKAGEFCLSIRSTAGNTVNYTAGVASSLKYSTGYTAKNGASYTREEFDGKLDIV
FT                   RASDGSIRQIWNLWDGLANIENVTESGYRIALYLPEQVDGKNSSTGLYPVTGDPFKTFT
FT                   ITGDAAAGRLAVTEQTAGRAPFTTRYWQGTDGAWNMSQGEGEDSIFTLKEKQIVSPGTW
FT                   KLITTIQRGENGIPISRVCETYAVTRNGNLCTSRIEGYGTDYARETTYEYTGMGKIAKE
FT                   TAPDGSVKTWAYDRFGREIVSSVPWAEAGDKVTYTTYRDQTQADPDILTQWVTLTATAA
FT                   ELWRTDYTYIEENHVRRVEKRTTALGEENVRLEVKESWLGTAPNVYARGRLKMKQDMGG
FT                   IQTHYAYEETDQYGALYKVTAETRIAGACVPGLSSRKVTYVSGQGNNMRYEQYVQLADG
FT                   VWSMTDASSYEYDVENRWVKRTRANGRVYERMMTCCGPLWEKDENGVTTSYSYNTARQL
FT                   TETIRSAIADGETMITPETITSYTRDALGKITSLRRDTGPMTTVESREYDLLGRLVKET
FT                   DILGRSTVRSYSGDGLVETVTTPAGATLITRKSASGTILRRYGTGQQDILYTVEVTEEG
FT                   IRTTEAVPGGEGGDPHVVTGSSTVNGFGDLVRVAAANTLNGENVRTLAYDNKGRLIREQ
FT                   LADMAPALYAYDAFGNRTRAIVALEDDPTILNSRITDYAYVTESREDGVYSLVSITSYT
FT                   SSGTPVLQKRAALLSALSPVLAGKTVMTDSRGHDAVEWMEYGGGSVRLRKKTVPGVESV
FT                   FLTRIVDGFTTAVTGFDGATVLRRRTYTETGITYADTDVRGNVFTSVCDIAGRIISGTD
FT                   AAGNTTTYAYGQPFDLPTCVTNPLGKTACSFYDIRGRKEAEWGTAVQPAVYAYDAAGHM
FT                   VSLSTFRVPGDVITTDPRLRTDGDITTWTYDIATGLVIRKTYADATHVDTVYDMLNRVA
FT                   ATTDARGTVASRSYAPLTGELVSITFNDDGFTPSISSLYNHLGQLTQIDDASGTRMFTY
FT                   NQYNEQETETTAGLAASVLTLRRDGVGRPAGYCLDYAGSPALQTAWAYDAYGRLSSVSL
FT                   NAVGKPFTYGYNEETGLLDTLDYPNTLKRWRTLEEKRDLPVKIDYLRPGSANYPAKTDY
FT                   SYDILGRPVTKKDYFNAPAPDLTHTCAYDDRNELVSDAMSRGGTYSYSYDNIGNRKTSL
FT                   EGTDSLPTTYVANRVNQYTDITEGEEAPFVPNYDADGNQTKLRTATGEWEASYNALNQA
FT                   VSFIQGDRRIECVYDYLNRRVEKSVYEGESLMSRKRFIYHGYLQIAELDATEVLESVAP
FT                   VLRKTYLWDPQEPVATRILAMGVFDETGAYVEDLYYTHDALKNTTALFGIKAGRRALYE
FT                   YGPYGSAVKMEGNAAELNPFRFSSEYADDELGLVYYNYRYYNPQNGRWISRDPMTEKES
FT                   YLLYGYVNNMPTLYSDELGLARTITTNKDDCSINVSLNIVIYPKGGDSINNIEMRTTAQ
FT                   RIKQSIESNWNGYEKGCCVVNVTADVSVQSRKSRWLYRFLNSDENNIEITSDSSHRSYV
FT                   NGVGGRYGVWGSQAVPWVYAHEAGHLMGLSDDYQDVANSDGSLTSVPNAGHEGHIMGEY
FT                   GGKANQHEIDAILKNIECPCDENQ"
FT                   /protein_id="YP_001876664.1"
FT   misc_feature    complement(47700..49196)
FT                   /note="Rhs family protein [Cell envelope biogenesis, outer
FT                   membrane]; Region: RhsA; COG3209"
FT                   /db_xref="CDD:33022"
FT                   /locus_tag="Amuc_0036"
FT   misc_feature    complement(46116..48098)
FT                   /note="Rhs family protein [Cell envelope biogenesis, outer
FT                   membrane]; Region: RhsA; COG3209"
FT                   /db_xref="CDD:33022"
FT                   /locus_tag="Amuc_0036"
FT   misc_feature    complement(46140..46376)
FT                   /note="RHS repeat-associated core domain; Region:
FT                   Rhs_assc_core; TIGR03696"
FT                   /db_xref="CDD:163408"
FT                   /locus_tag="Amuc_0036"
FT   gene            51964..53448
FT                   /db_xref="GeneID:6275166"
FT                   /locus_tag="Amuc_0037"
FT   CDS_pept        51964..53448
FT                   /locus_tag="Amuc_0037"
FT                   /gene_family="HOG000058004" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="amino acid permease-associated region"
FT                   /transl_table="11"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bmf:BAB2_0864 aromatic amino acid permease:amino
FT                   acid/polyamine transporter, family I:domain found in
FT                   permeases"
FT                   /db_xref="GI:187734553"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="GeneID:6275166"
FT                   /translation="MGVFTLAMINVSAIVSLRGMPAESTYGLSSVFYYIFAAVFFLVPV
FT                   SLVAAELTTGWPQKGGVYRWVGEAFGKKWGFLAIWLQWIESTIWFPTVLTFAAVSLAFM
FT                   GPGQRWDEALAANKWYVLIVVLCVYWAATLLNLRGMKTSAGVTKWGTIIGTIIPGAILI
FT                   LLGLGYWAGGNPILLDMSWDKLVPDMSNFNNLVLAASIFLFYAGMEMSAVHVKDVNNPG
FT                   RNYPLAILISAIITVLIFVLGTLAIGFIIPNSQINLVQSLLITYDSYFSFFGLGWMNWI
FT                   LALALAVGVLAQVTAWVGGPSKGLYQVGLAGNLPPVMQKRNKNNVQMGILFIQGGIVTL
FT                   LSIMFVIMPSVQSAYQIISQLTIILYLIMYMLMFASGIYLRYREPNTPRTFRIPGGRTF
FT                   GMWIVGGLGFLASLAAFLVSFIPPNQITVGSSTMYILLLVVGTFIFAGIPFIIHAMAKP
FT                   SWKRPVDPEDAFEPFGWEKNNDSHSAATPSHSISHE"
FT                   /protein_id="YP_001876665.1"
FT   misc_feature    51964..53391
FT                   /note="Transmembrane amino acid transporter protein;
FT                   Region: Aa_trans; cl00524"
FT                   /db_xref="CDD:176584"
FT                   /locus_tag="Amuc_0037"
FT   gene            53441..54382
FT                   /db_xref="GeneID:6275164"
FT                   /locus_tag="Amuc_0038"
FT   CDS_pept        53441..54382
FT                   /locus_tag="Amuc_0038"
FT                   /gene_family="HOG000216890" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glutaminase"
FT                   /EC_number="3.5.1.2"
FT                   /note="catalyzes the formation of glutamate from glutamine"
FT                   /db_xref="GI:187734554"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="GeneID:6275164"
FT                   /translation="MSDIPSNEQIRTALDNAYAYAKTVQGGKNASYIPALAQVPSDLLA
FT                   IAVVTVNGDLLTAGSADAPFAIESISKAFNLAYVMDLIGMKQLRAKIGADPTGEPFNSV
FT                   MAIELHGGKPLNPLVNAGAMATVSLVNGSDSDEIWGNMIHNFNNFANTALTVNQEIYKS
FT                   ESATNQHNRGIAWLLDSYGYFYNTPPMIVDLYTRMCSLNITASQLALMGACYANGGVNP
FT                   VSKKRVVKEENVPPILAEMCMSGLYDSTGDWMYKAGLPAKSGVGGGLVAVAPGKLAMAA
FT                   FSPPLDPAGNTVKGQAALQSIIRELNLNLFRS"
FT                   /transl_table="11"
FT                   /protein_id="YP_001876666.1"
FT   misc_feature    53441..54379
FT                   /note="Glutaminase; Region: Glutaminase; cl00907"
FT                   /db_xref="CDD:174450"
FT                   /locus_tag="Amuc_0038"
FT   gene            complement(54611..55021)
FT                   /db_xref="GeneID:6275161"
FT                   /locus_tag="Amuc_0039"
FT   CDS_pept        complement(54611..55021)
FT                   /locus_tag="Amuc_0039"
FT                   /gene_family="HOG000296051" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   cac:CA_P0110 NH2-acetyltransferase"
FT                   /db_xref="GI:187734555"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="GeneID:6275161"
FT                   /translation="MIVFTEEKKFSREDVQELFLSVGWISGQYPGRLFKALMNSSTVVT
FT                   AWDGDRLAGLVRVLDDSEMVAYMHYVLVHPAYQGRGIAGKMVEMVKEKYRDYLYLEIMP
FT                   EESRNAAFYEKHGFRVMEDGVAMQLCNFSNRS"
FT                   /protein_id="YP_001876667.1"
FT   misc_feature    complement(54734..54895)
FT                   /note="N-Acyltransferase superfamily: Various enzymes that
FT                   characteristically catalyze the transfer of an acyl group
FT                   to a substrate; Region: NAT_SF; cd04301"
FT                   /db_xref="CDD:173926"
FT                   /locus_tag="Amuc_0039"
FT   misc_feature    complement(order(54770..54775,54803..54811))
FT                   /note="Coenzyme A binding pocket; other site"
FT                   /db_xref="CDD:173926"
FT                   /locus_tag="Amuc_0039"
FT   gene            55485..56894
FT                   /db_xref="GeneID:6275160"
FT                   /locus_tag="Amuc_0040"
FT   CDS_pept        55485..56894
FT                   /locus_tag="Amuc_0040"
FT                   /gene_family="HOG000255106" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="amino acid carrier protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: amino acid carrier protein; PFAM:
FT                   sodium:alanine symporter; KEGG: dsy:DSY4985 hypothetical
FT                   protein"
FT                   /db_xref="GI:187734556"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="GeneID:6275160"
FT                   /translation="MLDALQNAFFQTGDTLTSWLSAFSSFLWGWPLLIMLLGTHLYLTA
FT                   ILRFPQRYLLKALKLYFVKDHTDKGDISPFSSLMVALAANIGAGNIIGVGVAIAAGGPG
FT                   AVFWCWLTGVLGMATRYSEGLLAIKYRVENKDGNMSGGPMFVLERGLNSKWLGAAFAVF
FT                   TAIAAFGIGNLTQGNAAAEQLHHAFSIPSWGTAAVLTALTALVMLGGIQGIARVCAFFV
FT                   PFMAVIYIMGCLYILTVQAEYIIPAIRYILDCAFTGEAAAGGAAGAAVMAAMRTGVARG
FT                   LFSNEAGLGSAAIASAAAQNRNPVRQALISSSGPFWDTVIICALTGIVLTTSIIAHPDI
FT                   SCTDGPRLTTLAFSKIPYIGSPLLTLSLVTFVVSTILGWSYFGEKALEYLGGIRLIMPY
FT                   RVIWVAAVFIGCVSKIELVWIFADCANGLMALPNLISLLALSGVLVQQTRYYLWQHRLD
FT                   DYDESHIPEGK"
FT                   /protein_id="YP_001876668.1"
FT   misc_feature    55521..56852
FT                   /note="Sodium:alanine symporter family; Region:
FT                   Na_Ala_symp; cl00548"
FT                   /db_xref="CDD:163871"
FT                   /locus_tag="Amuc_0040"
FT   gene            56982..57057
FT                   /note="tRNA-Glu1"
FT                   /db_xref="GeneID:6275159"
FT                   /locus_tag="Amuc_R0003"
FT   tRNA            56982..57057
FT                   /db_xref="GeneID:6275159"
FT                   /locus_tag="Amuc_R0003"
FT                   /product="tRNA-Glu"
FT   gene            57297..58373
FT                   /db_xref="GeneID:6275158"
FT                   /locus_tag="Amuc_0041"
FT   CDS_pept        57297..58373
FT                   /locus_tag="Amuc_0041"
FT                   /gene_family="HOG000074815" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="peptide chain release factor 1"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: peptide chain release factor 1; PFAM: Class
FT                   I peptide chain release factor; PCRF domain protein; KEGG:
FT                   hmo:HM1_1083 peptide chain release factor 1"
FT                   /db_xref="GI:187734557"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="GeneID:6275158"
FT                   /translation="MDYTPLIEKRRQRLEELETVIAEPDFFNDQKKASEIMREHRRLKE
FT                   LMETWDSLNATEQQLADNQELAKTDDPELAELAALEIPELEAALEKLRSDVQYSLLPRD
FT                   TTEDRDAIIEIRAGTGGDEASLFAGDLLRMYQRFAEERGWRFEHLESSPSDVGGFKEVV
FT                   CRIAGEEVFRFLKYEGGVHRVQRVPATETQGRIHTSTATVAVMPEAEEVDIEIRPEDLR
FT                   IEVCRSGGAGGQHVNKTESAVQIWHIPTGVYVRCEEERSQMKNREKGMKILRAKLFEAK
FT                   KREEAEKYSAARRNLIGSGGREEKIRTYNFPQNRLTDHRIGYTSHNLDGILMGQLEDLI
FT                   MALQHAEMQERLAEAGMS"
FT                   /protein_id="YP_001876669.1"
FT   misc_feature    57330..58364
FT                   /note="peptide chain release factor 1; Validated; Region:
FT                   prfA; PRK00591"
FT                   /db_xref="CDD:167010"
FT                   /locus_tag="Amuc_0041"
FT   misc_feature    <57579..57830
FT                   /note="RF-1 domain; Region: RF-1; cl02875"
FT                   /db_xref="CDD:174736"
FT                   /locus_tag="Amuc_0041"
FT   misc_feature    57915..58256
FT                   /note="RF-1 domain; Region: RF-1; cl02875"
FT                   /db_xref="CDD:174736"
FT                   /locus_tag="Amuc_0041"
FT   gene            58390..59295
FT                   /db_xref="GeneID:6275157"
FT                   /locus_tag="Amuc_0042"
FT   CDS_pept        58390..59295
FT                   /locus_tag="Amuc_0042"
FT                   /gene_family="HOG000076274" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein-(glutamine-N5) methyltransferase, release
FT                   factor-specific"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: modification methylase, HemK family;
FT                   protein-(glutamine-N5) methyltransferase, release
FT                   factor-specific; PFAM: methyltransferase small; KEGG:
FT                   mxa:MXAN_4908 putative protein methyltransferase HemK"
FT                   /db_xref="GI:187734558"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR017759"
FT                   /db_xref="GeneID:6275157"
FT                   /translation="MKTLLEVLQAGTDYLARQGCDEARATMQHLLAHVLHCNRTALYSQ
FT                   FDRPVEEAELAPLRELLKRRAAGEPLQHLLGVTEFFRRDFLTDARALIPRPETEELVEM
FT                   VLKKIPDHPVRILDMGTGSGVIGVTLALELKERAGEVVLADISPQALDLALENAMRLGA
FT                   RVSTIQTNLFANISQEKTDPHAEDADSAPEGKKGENGRNMLFDVIVANLPYIAEGEKLA
FT                   PEVMKDPHTALFGGPKGWEIIERFLARARDYLNEDGFVALEIGYDQASVVTQIMDGYGY
FT                   NYIEVLKDMSGVSRFPFGYR"
FT                   /protein_id="YP_001876670.1"
FT   misc_feature    58471..59277
FT                   /note="protein-(glutamine-N5) methyltransferase, release
FT                   factor-specific; Region: RF_mod_PrmC; TIGR03534"
FT                   /db_xref="CDD:163311"
FT                   /locus_tag="Amuc_0042"
FT   misc_feature    <58642..59184
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cl12011"
FT                   /db_xref="CDD:176836"
FT                   /locus_tag="Amuc_0042"
FT   gene            59317..61533
FT                   /db_xref="GeneID:6275154"
FT                   /locus_tag="Amuc_0043"
FT   CDS_pept        59317..61533
FT                   /locus_tag="Amuc_0043"
FT                   /gene_family="HOG000037414" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="primosomal protein N'"
FT                   /transl_table="11"
FT                   /note="KEGG: pcu:pc1225 primosome assembly protein PriA;
FT                   TIGRFAM: primosomal protein N'; PFAM: helicase domain
FT                   protein; type III restriction protein res subunit;
FT                   DEAD/DEAH box helicase domain protein; SMART: DEAD-like
FT                   helicases"
FT                   /db_xref="GI:187734559"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="GeneID:6275154"
FT                   /translation="MQAARILVDGQSDLVLDYGIPPEAGDVKPGCRVQVPLRNRTATGT
FT                   VLTLSEPAPAWKDRLKPILKLIDPEPLISPVMMNLASWAADYYSVALDQMIRCLLPETV
FT                   RQENTAEKMRKMVYLEKTPAREELDALYRKAPRQAQMLDYFSSAKQQSAPLAAFGAGAL
FT                   NVARSLEAKGFISLKEEAVHRDPSTGEQFVPTQPMKLNSQQQKALEEITAMCAAERKKP
FT                   VLLQGVTGSGKTEVYLQAVSQIVKSGKSALIMVPEISLTPQTVQRFKSRFAELPSSVAV
FT                   LHSLLSDGERFDEWHAIRSGKARIVIGPRSAVFAPLQNLGLVIVDEEHDASYKQESSPR
FT                   YHGRDLAVLRAHLENCAVLLGSATPSLESIHNALIGKYSLVKLTERADGQQLPLIRILD
FT                   MKTEGRNKSGPNVISERLRMSIDRRLDKGEQVILLLNRRGFARSIQCPDCGHVVTCLHC
FT                   SLPLTYHRTEDRLMCHLCGFKALPPRSCPECRSANILLQGYGTQKVEELLRRTFPAARI
FT                   TRVDADVARRKNAVRTILNQFRAHKIDILLGTQMIAKGLDFPNVTLVGVLNADLGLHIP
FT                   DPRAGERTFQLLTQVAGRAGRGDLSGEVIIQTFTPQSPSLQYARHHDTDGFAAQELEMR
FT                   RTFDLPPFTHIAVLTIRSQHESMAEFATQTLAARLRGMLPPPATMTDPMPAPIPRAHGQ
FT                   FRFQITVKGPSARILSRTLRKLVQEAGLGEDLTAVIDVDAMSFM"
FT                   /protein_id="YP_001876671.1"
FT   misc_feature    59317..61530
FT                   /note="primosome assembly protein PriA; Validated; Region:
FT                   PRK05580"
FT                   /db_xref="CDD:168108"
FT                   /locus_tag="Amuc_0043"
FT   misc_feature    59983..60411
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cd00046"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Amuc_0043"
FT   misc_feature    60004..60018
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Amuc_0043"
FT   misc_feature    60292..60303
FT                   /note="putative Mg++ binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Amuc_0043"
FT   misc_feature    <60913..61134
FT                   /note="Helicase superfamily c-terminal domain; associated
FT                   with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation
FT                   factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this
FT                   domain is found in a wide variety of helicases and helicase
FT                   related proteins; may...; Region: HELICc; cd00079"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="Amuc_0043"
FT   misc_feature    order(60985..60987,61084..61086,61096..61098,61105..61107)
FT                   /note="ATP-binding site; other site"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="Amuc_0043"
FT   gene            61593..62417
FT                   /db_xref="GeneID:6275152"
FT                   /locus_tag="Amuc_0044"
FT   CDS_pept        61593..62417
FT                   /locus_tag="Amuc_0044"
FT                   /gene_family="HOG000220466" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="PFAM: diaminopimelate epimerase; KEGG: sat:SYN_00169
FT                   diaminopimelate epimerase"
FT                   /db_xref="GI:187734560"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="GeneID:6275152"
FT                   /translation="MLLHFYKMTGAGNDFVMVDNRDLSLSSVLDRETIEALCDRRFGIG
FT                   ADGLIAVEPSQGKGGIVRMRYYNADGGEAEMCGNGARCFGNFAAALLHHDKTAPLPFET
FT                   MAGVVTATFEKDGNVTVNLTNPHSMQLFVLNADPTVGADVHFLNTGVPHAVAFLDKLEG
FT                   LDISRLGAYLRYHEAFSPKGTNANFARILSPGHIAIRTYERGVEDETLACGTGMTACAL
FT                   LHAVLTDAPSPIQVDVAGGDTLKVGFQRTGDRFTDVTLTGPADLVFTGDIQI"
FT                   /transl_table="11"
FT                   /protein_id="YP_001876672.1"
FT   misc_feature    61593..62414
FT                   /note="diaminopimelate epimerase; Provisional; Region:
FT                   dapF; PRK00450"
FT                   /db_xref="CDD:166970"
FT                   /locus_tag="Amuc_0044"
FT   misc_feature    61605..61970
FT                   /note="Diaminopimelate epimerase; Region: DAP_epimerase;
FT                   pfam01678"
FT                   /db_xref="CDD:145037"
FT                   /locus_tag="Amuc_0044"
FT   misc_feature    62034..62318
FT                   /note="Diaminopimelate epimerase; Region: DAP_epimerase;
FT                   pfam01678"
FT                   /db_xref="CDD:145037"
FT                   /locus_tag="Amuc_0044"
FT   gene            complement(62461..63240)
FT                   /db_xref="GeneID:6275149"
FT                   /locus_tag="Amuc_0045"
FT   CDS_pept        complement(62461..63240)
FT                   /locus_tag="Amuc_0045"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:187734561"
FT                   /db_xref="GeneID:6275149"
FT                   /translation="MNFFPHIPMLSTVFNNIGCYLLPFGVVLLWLLYESKKVKTILLAA
FT                   LVLLSMVCMFFHEAFAPSREYPWDCMVEHIFTGTLLPFLCLLGYLLYVFLCTCIPVYRK
FT                   VWKGIGFFVLGGMSLAFEYVNVFFPVALLAGYLFRFTIFRKFRNHLPLVRKCHGVLAVG
FT                   VIPGICLIGVVSAILFPPPESFICDRIHEEMERDMALWNYQSNLVLLSSRFLNMERENG
FT                   CITVKYYCETNMGPAVYKAFCNNYGGYVRAECSLLNR"
FT                   /protein_id="YP_001876673.1"
FT   gene            complement(63380..63646)
FT                   /db_xref="GeneID:6275146"
FT                   /locus_tag="Amuc_0046"
FT   CDS_pept        complement(63380..63646)
FT                   /locus_tag="Amuc_0046"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:187734562"
FT                   /db_xref="GeneID:6275146"
FT                   /translation="MGIDVIYAAFRADPVGSVFPCPEGPVGSVFSRHHSGTQRRIFRKE
FT                   RFAAALGKAEENRKEDGLDEKVVFHKSVTILFRGLFCQVGEPG"
FT                   /protein_id="YP_001876674.1"
FT   gene            63857..63931
FT                   /note="tRNA-His1"
FT                   /db_xref="GeneID:6275144"
FT                   /locus_tag="Amuc_R0004"
FT   tRNA            63857..63931
FT                   /db_xref="GeneID:6275144"
FT                   /locus_tag="Amuc_R0004"
FT                   /product="tRNA-His"
FT   gene            63997..64668
FT                   /db_xref="GeneID:6275141"
FT                   /locus_tag="Amuc_0047"
FT   CDS_pept        63997..64668
FT                   /locus_tag="Amuc_0047"
FT                   /gene_family="HOG000249464" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: ubiquinone/menaquinone biosynthesis
FT                   methyltransferase; PFAM: UbiE/COQ5 methyltransferase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   ttj:TTHA1854 ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /db_xref="GI:187734563"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="GeneID:6275141"
FT                   /translation="MRNPEFVKAAFSAIAPRYVATNHVLSMGVDLLWRQRVVQLVSEWK
FT                   PENLLDLATGTGDLALAILNAMPEIRLTGSDFCQPMLDIAARRGLDHLVCADAMNLPFP
FT                   SASYDAVTVAFGLRNMASYPDALREMGRMLRPGGHLLILDFSLPESLLKSPYRFYLHRI
FT                   LPVIAGWMTGHREAYDYLADSIEAFPCGQAMKTLLRECGYSNITAEALNGGIASIYTAQ
FT                   R"
FT                   /protein_id="YP_001876675.1"
FT   misc_feature    64003..64659
FT                   /note="ubiE/COQ5 methyltransferase family; Region:
FT                   Ubie_methyltran; pfam01209"
FT                   /db_xref="CDD:110227"
FT                   /locus_tag="Amuc_0047"
FT   misc_feature    64138..64422
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cd02440"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="Amuc_0047"
FT   misc_feature    order(64150..64170,64222..64227,64282..64290,64336..64338)
FT                   /note="S-adenosylmethionine binding site; other site"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="Amuc_0047"
FT   gene            64665..66170
FT                   /db_xref="GeneID:6275137"
FT                   /locus_tag="Amuc_0048"
FT   CDS_pept        64665..66170
FT                   /locus_tag="Amuc_0048"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="MATE efflux family protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: hau:Haur_3692
FT                   MATE efflux family protein"
FT                   /db_xref="GI:187734564"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="GeneID:6275137"
FT                   /translation="MSAGDAREGIIRGKAARARLGGKLAGLSLPRQIAVIAFWPFLEQL
FT                   LSFFVTSSDLFIATKIGVDAQDTINISDGMGAVVFIMWFGFVIQGSIMMGATAIVSRMT
FT                   GARDYPQAQHGLHQAAMLGLLAGTISCGLLFTCSDFLVTHVLTMNETARAYALQYVYMA
FT                   AFAAPFSGVVFAINAALRGSGDTRLPFWIMMSVGILNVIFSVIFVFADAPLGGWRIGGI
FT                   AAGTVCGYGISMCILLFIMLRRRKKIFTGRKNESLEELVRERGEHYAPPLYLSFSHLRP
FT                   DMGMQKRILKIGLPQAVEVFGMWGIQMFCLSIISELPVKGVLGVHNIAVRIESLSFLPG
FT                   FAIGMAASTLVGQYLGARNALMARITIWKCMRYAVIFMTGLGVLFSAFPALFMEIFSNG
FT                   STTLIDTGIPVLRTMLVVEPFFAACIVMKMSLRGAGDTRRVMLISYGIMGFFRVVCTWV
FT                   WFRLAPETMTLWGIWLVFAFEMAVQSAILYKIVKGRSWTKLQV"
FT                   /protein_id="YP_001876676.1"
FT   misc_feature    64746..66167
FT                   /note="Na+-driven multidrug efflux pump [Defense
FT                   mechanisms]; Region: NorM; COG0534"
FT                   /db_xref="CDD:30880"
FT                   /locus_tag="Amuc_0048"
FT   misc_feature    64785..65282
FT                   /note="MatE; Region: MatE; pfam01554"
FT                   /db_xref="CDD:144956"
FT                   /locus_tag="Amuc_0048"
FT   misc_feature    65547..65996
FT                   /note="MatE; Region: MatE; pfam01554"
FT                   /db_xref="CDD:144956"
FT                   /locus_tag="Amuc_0048"
FT   gene            66291..66366
FT                   /note="tRNA-Met1"
FT                   /db_xref="GeneID:6275135"
FT                   /locus_tag="Amuc_R0005"
FT   tRNA            66291..66366
FT                   /db_xref="GeneID:6275135"
FT                   /locus_tag="Amuc_R0005"
FT                   /product="tRNA-Met"
FT   gene            complement(66361..66591)
FT                   /db_xref="GeneID:6275133"
FT                   /locus_tag="Amuc_0049"
FT   CDS_pept        complement(66361..66591)
FT                   /locus_tag="Amuc_0049"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:187734565"
FT                   /db_xref="GeneID:6275133"
FT                   /translation="MNFHYPEIPHRISGWLLYLYGDVFGMDLPTGEFAGSRFEAPSYAG
FT                   GEAEASSTGAFFFCAGKGNPLQVKSLQGVIW"
FT                   /protein_id="YP_001876677.1"
FT   gene            complement(66594..67443)
FT                   /db_xref="GeneID:6275125"
FT                   /locus_tag="Amuc_0050"
FT                   /pseudo
FT   gene            complement(68018..69757)
FT                   /db_xref="GeneID:6275121"
FT                   /locus_tag="Amuc_0051"
FT   CDS_pept        complement(68018..69757)
FT                   /locus_tag="Amuc_0051"
FT                   /gene_family="HOG000018413" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="single-stranded-DNA-specific exonuclease RecJ"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: single-stranded-DNA-specific exonuclease
FT                   RecJ; PFAM: phosphoesterase RecJ domain protein;
FT                   phosphoesterase DHHA1; KEGG: gme:Gmet_0857 RecJ
FT                   exonuclease"
FT                   /db_xref="GI:187734566"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="GeneID:6275121"
FT                   /translation="MTPGFHWTLRPSVKEDDPVLKAFPAELPLLVKQLLLQRGFTGGME
FT                   TELFLDPRLSHLSDPFLMGEMRAAVDRIFRAVDEGETVCIYGDYDVDGVTSVALLRAIL
FT                   MAYDLDPQYFIPVRSREGYGLSEAGIKRCLCECADPPSLLITVDCGTSSVKEVDMLNSL
FT                   GIDVIILDHHEAGPLGRPDAAAVVNAKIEENSPYTYLCSAGVVFKLAHALLKERKLKTF
FT                   DLKLYLDLVAVATVADIVPLVAENRILVRHGLGRLAHSRHTGLKTLTEIAGIRPSDSVN
FT                   HAGFLNAAHVGFRIGPRINAAGRMDSPMDALELLLTMDARRAVQLAQMLDSHNRKRQEE
FT                   EEAIRTDAVEMLHNSFDPERDNVIVLGSRAWHPGVVGIVASQLMRRYHKPTFVIAFDES
FT                   GVGKGSGRSIPGVSLVQAIHHCADTLVSGGGHDMAAGLVIEESRMDDFRRAFNRYVSET
FT                   TTEEQRSPVLNIDMEVSFQALTLDLLDSYEKLEPFGNSNPQPLFMSSDVFPTEPPKRVG
FT                   TNHLKLFMRQGIVERDAIFFNGAERELPNPPWDIAFTIDRNVYRGRASLSISIQEIRSH
FT                   REM"
FT                   /protein_id="YP_001876678.1"
FT   misc_feature    complement(68039..69649)
FT                   /note="single-stranded-DNA-specific exonuclease RecJ;
FT                   Region: recJ; TIGR00644"
FT                   /db_xref="CDD:161976"
FT                   /locus_tag="Amuc_0051"
FT   misc_feature    complement(69050..69532)
FT                   /note="DHH family; Region: DHH; pfam01368"
FT                   /db_xref="CDD:144819"
FT                   /locus_tag="Amuc_0051"
FT   misc_feature    complement(68399..68596)
FT                   /note="DHHA1 domain; Region: DHHA1; pfam02272"
FT                   /db_xref="CDD:145431"
FT                   /locus_tag="Amuc_0051"
FT   gene            complement(69948..72809)
FT                   /db_xref="GeneID:6275118"
FT                   /locus_tag="Amuc_0052"
FT   CDS_pept        complement(69948..72809)
FT                   /locus_tag="Amuc_0052"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Hyalurononglucosaminidase"
FT                   /EC_number="3.2.1.35"
FT                   /note="PFAM: coagulation factor 5/8 type domain protein;
FT                   Hyaluronidase; KEGG: bfs:BF3796 putative exported
FT                   hyaluronidase"
FT                   /db_xref="GI:187734567"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR011496"
FT                   /db_xref="GeneID:6275118"
FT                   /translation="MNGFQLLQCGLSVAAFLAGSALAATPAVYPSPQQSKFTSQTVAFS
FT                   GKPSVTIRSAKAGGSKLLDGVPEKSGAYKLVISPQGKVGIGAHDERGAFYAMQTLRQLG
FT                   TKTGGEGVILPVGEITDWPDIEFRGTVEGFYGTPWSHEARLSQLRFYGQNKMNTYIYGP
FT                   KDDPYHSSPHWRDPYPADQAAQIRELVKVAKENHVDFVWAIHPGKDIKWTEEDMNNVIK
FT                   KFEMMYKLGVRSFAVFFDDIFGEGKRGDMQALLLNKINDEFVKVKKDVTPLVMCPTEYN
FT                   RGWANPKPGTYLDILGDRLDPSIHVMWTGNSVCHDITLEGQQWVNRRIKRPSYVWWNFP
FT                   VTDYCRSNLCMGRVYGLATEPGARESMGGFVSNPMDKPEASKVSLFGLADYSWNINGFK
FT                   SEESWKEGVRRLFPKAAEAMQVFVNHNSDQGPNGHGYRREESVEIEPVVKRVLEAAREG
FT                   RIEKADAALLKKEFARMASAAPVIRAKADNPRLMKEIGAWVDAFEQLGRAGQHAVAALE
FT                   ENNAGEAATHLVQATQALAAMDGISRRHNQEGQLYRSAVKTGSRVMAPAVNELADIVSK
FT                   KVFPAIAGAPALSPKPLVKGGSMDKAELFCDGDRGSFWHSGAYGQPGDWYGVDYGMPIP
FT                   VRSVEVLMGRNDKDGDYVEKGQLEGSRDLKTWKPLGPETAGMQVAWKAPKPVLLRAVRY
FT                   RVIEPKKTGNGRAVWTAVREIAVNTPPSAMASSNVAGLEGVSVQKSDKIVRINRVMETH
FT                   KMKPGEFISLRLDGPTDATWLEVNLERDDVNSWAEVVLDVEGSSKPVVQKLDKQGKNFI
FT                   ARGNQLPKGIKGMKLVNKSGKEQDIVLNMFKFDVPPSDPGTSLVSLSDRNLKTVYRADK
FT                   PLDVVVPNLDNPRASKVVVVGSAAFAIQARRGEGAWTLVGKRNAGPGVSEFAIPAGTSA
FT                   VRLTYKAPQPDAIINEVIFSSRK"
FT                   /transl_table="11"
FT                   /protein_id="YP_001876679.1"
FT   sig_peptide     complement(72738..72809)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT                   /locus_tag="Amuc_0052"
FT   misc_feature    complement(<72423..>72617)
FT                   /note="N-acetyl-beta-hexosaminidase [Carbohydrate transport
FT                   and metabolism]; Region: Chb; COG3525"
FT                   /db_xref="CDD:33328"
FT                   /locus_tag="Amuc_0052"
FT   misc_feature    complement(71532..72428)
FT                   /note="beta-N-acetylglucosaminidase; Region: NAGidase;
FT                   pfam07555"
FT                   /db_xref="CDD:148908"
FT                   /locus_tag="Amuc_0052"
FT   misc_feature    complement(70665..70991)
FT                   /note="Coagulation factor 5/8 C-terminal domain, discoidin
FT                   domain; Cell surface-attached carbohydrate-binding domain,
FT                   present in eukaryotes and assumed to have horizontally
FT                   transferred to eubacterial genomes; Region: FA58C; cl12042"
FT                   /db_xref="CDD:176621"
FT                   /locus_tag="Amuc_0052"
FT   gene            73252..74193
FT                   /db_xref="GeneID:6275114"
FT                   /locus_tag="Amuc_0053"
FT   CDS_pept        73252..74193
FT                   /locus_tag="Amuc_0053"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="periplasmic solute binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   csa:Csal_0220 periplasmic solute binding protein"
FT                   /db_xref="GI:187734568"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="GeneID:6275114"
FT                   /translation="MRNMLRRILIPFLCLLGLFCSLQAQDAPVLKIAVLHPVLGDMARA
FT                   IGGSRVQVADLLRPNGNLHSFEPSPQDIAAAGRARLVLASGKNLEPYLPKLKDALGGSA
FT                   QILDLGASVPDVPVEEDTADHDHEHDGDCCAHGPNDPHWWHTPANMKRAARTLAATLTR
FT                   LDPDHEQDYKVGLSRWNRKMDQLSSWARKELADIPETDRVLVTGHAAMNHFCREFGFRS
FT                   ISIQGISREDEGNSAQLASTLKKLRSAGVKALFPEYSSNPKSLTEIAKSLNIPVARPIN
FT                   TDGLAPEGHTFESMFRQNTGIIKEALSPSPRP"
FT                   /protein_id="YP_001876680.1"
FT   sig_peptide     73252..73326
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 25"
FT                   /locus_tag="Amuc_0053"
FT   misc_feature    73294..74175
FT                   /note="Helical backbone metal receptor (TroA-like domain).
FT                   These proteins have been shown to function in the ABC
FT                   transport of ferric siderophores and metal ions such as
FT                   Mn2+, Fe3+, Cu2+ and/or Zn2+.  Their ligand binding site is
FT                   formed in the interface...; Region: TroA-like; cl00262"
FT                   /db_xref="CDD:174075"
FT                   /locus_tag="Amuc_0053"
FT   misc_feature    order(73531..73536,73543..73545,73726..73728)
FT                   /note="intersubunit interface; other site"
FT                   /db_xref="CDD:29734"
FT                   /locus_tag="Amuc_0053"
FT   gene            74190..74624
FT                   /db_xref="GeneID:6275112"
FT                   /locus_tag="Amuc_0054"
FT   CDS_pept        74190..74624
FT                   /locus_tag="Amuc_0054"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:187734569"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="GeneID:6275112"
FT                   /translation="MTSTPLRQFFPTLGVVILLGFFLYNMTAPTTGSQEAEHSAPTAQT
FT                   ADVPTVITVRCAHRPEALSISCGGRLLWQPETPGLHEETECGLPLKNGSVTLTVSARWP
FT                   ENTPDTPVTLELEPEGKTTVSATRWSFGPSLNDSYSFSWK"
FT                   /protein_id="YP_001876681.1"
FT   sig_peptide     74190..74273
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.809) with cleavage site probability 0.576 at
FT                   residue 28"
FT                   /locus_tag="Amuc_0054"
FT   gene            74621..75421
FT                   /db_xref="GeneID:6275110"
FT                   /locus_tag="Amuc_0055"
FT   CDS_pept        74621..75421
FT                   /locus_tag="Amuc_0055"
FT                   /codon_start="1"
FT                   /product="ABC transporter related"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rrs:RoseRS_1257 ABC transporter related"
FT                   /db_xref="GI:187734570"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:6275110"
FT                   /translation="MNSPAPPCTQDHICWGAHASHPDRHRLEVDSLSVYYGSLLALNGI
FT                   SFSITCGHTLALMGPNGAGKSTLIKALAGLIRPDSGKILWNGCPLHDTPGEIAYLPQRS
FT                   DVDWSFPITVRALVEMGRYPSLGLWKKFGRHDRDIVEKSLHVLGMESLADRQISELSGG
FT                   QQQRAFLARALAQEAHVLLLDEPFTGLDAPASQSLGRLLDSLSAEGRLVIASHHDLNTA
FT                   ADIFDTILLMNRELAAFGPPKEVLTPARIRETYGMEPQPETQAS"
FT                   /protein_id="YP_001876682.1"
FT   misc_feature    74699..75388
FT                   /note="ABC-type Mn/Zn transport systems, ATPase component
FT                   [Inorganic ion transport and metabolism]; Region: ZnuC;
FT                   COG1121"
FT                   /db_xref="CDD:31318"
FT                   /locus_tag="Amuc_0055"
FT   misc_feature    74702..75340
FT                   /note="ABC component of the metal-type transporters.  This
FT                   family includes transporters involved in the uptake of
FT                   various metallic cations such as iron, manganese, and zinc.
FT                   The ATPases of this group of transporters are very similar
FT                   to members of iron...; Region: ABC_Metallic_Cations;
FT                   cd03235"
FT                   /db_xref="CDD:72994"
FT                   /locus_tag="Amuc_0055"
FT   gene            75418..76281
FT                   /db_xref="GeneID:6275108"
FT                   /locus_tag="Amuc_0056"
FT   CDS_pept        75418..76281
FT                   /locus_tag="Amuc_0056"
FT                   /gene_family="HOG000181428" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ABC-3 protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC-3 protein; KEGG: btl:BALH_2849 manganese
FT                   ABC transporter, permease"
FT                   /db_xref="GI:187734571"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="GeneID:6275108"
FT                   /translation="MMDDFLQFLREPIAQRSLLACVMIGFANGFVSGLVILKKSALQIG
FT                   TLSCALLPGIAVAVLLFGLTRWSLLTGAVVAALLVGLGSLFVSRTSRLNQDTALSILHT
FT                   TAFAAGFIVLVRLGLQQKIDDWLFGSIMSLSDSDLWIAFAISSVSVLILLLFRRPILIC
FT                   LFDPDIATTLGIPSRLISYGIFTLIILVLVSSLQAVGAFLTLGLLVGPAATVYLLTNKP
FT                   SHLFWGGGIIGGLGSLLAFYLSFPLGWHLGATIILVLGVIFCTAYLYSSRCGRLKQRGK
FT                   NSSQVQ"
FT                   /protein_id="YP_001876683.1"
FT   misc_feature    75460..76206
FT                   /note="Transmembrane subunit (TM), of Periplasmic Binding
FT                   Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters involved in the uptake of siderophores, heme,
FT                   vitamin B12, or the divalent cations Mg2+ and Zn2+.
FT                   PBP-dependent ABC transporters consist...; Region:
FT                   TM_ABC_iron-siderophores_like; cd06550"
FT                   /db_xref="CDD:119348"
FT                   /locus_tag="Amuc_0056"
FT   misc_feature    order(75511..75513,75523..75531,75877..75882,75886..75894,
FT                   75898..75903,75907..75924,75928..75936,76060..76062,
FT                   76081..76083)
FT                   /note="ABC-ATPase subunit  interface; other site"
FT                   /db_xref="CDD:119348"
FT                   /locus_tag="Amuc_0056"
FT   misc_feature    order(75526..75528,75532..75534,75547..75549,75700..75702,
FT                   75706..75711,75718..75723,75730..75735,75742..75744,
FT                   75751..75756,75760..75762,75787..75792,75799..75801,
FT                   76027..76029,76174..76176,76183..76188,76195..76197,
FT                   76204..76206)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119348"
FT                   /locus_tag="Amuc_0056"
FT   misc_feature    order(75760..75762,75829..75831,76003..76005,76015..76017,
FT                   76165..76167)
FT                   /note="putative PBP binding regions; other site"
FT                   /db_xref="CDD:119348"
FT                   /locus_tag="Amuc_0056"
FT   gene            76349..76885
FT                   /db_xref="GeneID:6275104"
FT                   /locus_tag="Amuc_0057"
FT   CDS_pept        76349..76885
FT                   /locus_tag="Amuc_0057"
FT                   /gene_family="HOG000218089" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="UvrB/UvrC protein"
FT                   /transl_table="11"
FT                   /note="PFAM: UvrB/UvrC protein; KEGG: tte:TTE2329
FT                   hypothetical protein"
FT                   /db_xref="GI:187734572"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="GeneID:6275104"
FT                   /translation="MRVVKKCEICSAPATVFLTQIINGKSTKFCLCAKCAQERGLLDPD
FT                   AFDLAEKLFPNLQGQFGKEGAAGPAAPIPALQSLPLTSCPICSFTLQDYKNVGRLGCSE
FT                   CYNVFEEEILPLLTQIQPDSHHHGKTPERAEKRETETHTISDLEQQLSLAVAREDYERA
FT                   AKLRDQIKQLRTPTN"
FT                   /protein_id="YP_001876684.1"
FT   misc_feature    76364..76873
FT                   /note="Modulator of heat shock repressor CtsR, McsA [Signal
FT                   transduction    mechanisms]; Region: COG3880"
FT                   /db_xref="CDD:33669"
FT                   /locus_tag="Amuc_0057"
FT   misc_feature    76778..76870
FT                   /note="UvrB/uvrC motif; Region: UVR; pfam02151"
FT                   /db_xref="CDD:145355"
FT                   /locus_tag="Amuc_0057"
FT   gene            76891..77946
FT                   /db_xref="GeneID:6275102"
FT                   /locus_tag="Amuc_0058"
FT   CDS_pept        76891..77946
FT                   /locus_tag="Amuc_0058"
FT                   /gene_family="HOG000082112" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATP:guanido phosphotransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: ATP:guanido phosphotransferase; KEGG:
FT                   mta:Moth_0161 ATP:guanido phosphotransferase"
FT                   /db_xref="GI:187734573"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="GeneID:6275102"
FT                   /translation="MLFDDLLNNPAKWMVESRDEHDIVLTSRIRLARNLTATPFPGWAT
FT                   RQQREETLKLTSGEARQIPVMKGGYYAELSGLTQQQKQLLVERHLISRELAARSEGCAV
FT                   LISRSQNASILFNEEDHLRLQYILPGIQLKKAWGAISKIDSELEARLPYAYNTRLGYIT
FT                   ACPTNLGTGMRASVMMHLPGLVISEQMQQVVQAAAQLNITVRGLYGEGTEATGNLFQIS
FT                   NQSTLGDSEDQIVERMTRFTSDLAHQEWNARRRLLQSSSLQVKDRVSRAYGLLTNATLL
FT                   STQEALALLSFLRMGASLDIFSHQALKNVNKTIMNIQPAHLARLSTTDQTTPEHRDQIR
FT                   ADIIRKELSGN"
FT                   /protein_id="YP_001876685.1"
FT   misc_feature    76894..77928
FT                   /note="ATP:guanido phosphotransferase; Provisional; Region:
FT                   PRK01059"
FT                   /db_xref="CDD:167148"
FT                   /locus_tag="Amuc_0058"
FT   misc_feature    76951..77646
FT                   /note="Phosphagen (guanidino) kinases found in bacteria;
FT                   Region: bacterial_phosphagen_kinase; cd07930"
FT                   /db_xref="CDD:153077"
FT                   /locus_tag="Amuc_0058"
FT   misc_feature    order(76966..76968,76972..76974,76978..76980,77155..77157,
FT                   77233..77235,77257..77259,77410..77412,77416..77424,
FT                   77503..77505,77509..77511,77515..77520,77548..77550)
FT                   /note="ADP binding site; other site"
FT                   /db_xref="CDD:153077"
FT                   /locus_tag="Amuc_0058"
FT   misc_feature    order(77245..77247,77383..77385,77521..77526)
FT                   /note="phosphagen binding site; other site"
FT                   /db_xref="CDD:153077"
FT                   /locus_tag="Amuc_0058"
FT   misc_feature    order(77494..77538,77542..77559)
FT                   /note="substrate specificity loop; other site"
FT                   /db_xref="CDD:153077"
FT                   /locus_tag="Amuc_0058"
FT   gene            77975..80557
FT                   /db_xref="GeneID:6275100"
FT                   /locus_tag="Amuc_0059"
FT   CDS_pept        77975..80557
FT                   /locus_tag="Amuc_0059"
FT                   /gene_family="HOG000218210" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: UvrB/UvrC protein; AAA ATPase central domain
FT                   protein; Clp domain protein; ATPase associated with various
FT                   cellular activities AAA_5; ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase; KEGG: pcu:pc1511 probable endopeptidase
FT                   ATP-binding chain ClpC"
FT                   /db_xref="GI:187734574"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR013093"
FT                   /db_xref="GeneID:6275100"
FT                   /translation="MNNFTPRAQQVLAHARREADRFNHHYIGTEHLLLGLLKLGKGVAV
FT                   TILENLGVELTAVRKQVEEQIGRGTEPQAEGNIPYTPRVRKVLAMANREAQELNHTYVG
FT                   TEHLLLGLIRDGDGVAGQILRHFGVDLEQARRELLDVLTPKYQMDADEDNIIPDDDDDE
FT                   EENESPAIPTDEPSSPSYSRQQKSKTPALQAFGRDMTQLARDGKLDPVIGRASEIERVI
FT                   QILCRRNKNNPVLLGEAGVGKTAIVEGLAQEIAQGHVPELLRSKRVISLDLALMVAGTK
FT                   YRGQFEERLKAVMDEIRREGNVILFIDELHTIVGAGSAEGSMDASNIIKPALSRGELQA
FT                   IGATTLNEYRKHIEKDAALERRFQQVQVGEPSVEDTIQILAGIQPKYEEHHKVHYTKEA
FT                   VEAAAKLSHRYLTGRFLPDKAIDILDEAGARKRVSQMTRPDHISNMEIRIAEIKERKDK
FT                   AVETQLFEEAARLRDEEKQAKAELQNMLETWRNSYETNYVPVTDEDVMSVLAKWTGIPL
FT                   ARMEEKETTKLLRMEEELKSKVIGQDEAASAIARALRRSRADIKDPRRPIGSFLFLGPT
FT                   GVGKTYLARNLAEIMFGTSDALIQVDMSEYMEKHTTSRLIGSPPGYVGHDEGGQLTEAV
FT                   RRRPYSVILFDEVEKAHPDVMNLLLQILEEGSVTDSLGRKINFRNTIIILTSNVGAASA
FT                   KRQSTMGFGAMAADNADYAAMKEKILEAARKQFRPEFLNRFDDISVFRMLERDDLERIV
FT                   HLEADKLISRLKTKNITLALSQEALSLIIKNGYDPQYGARPMRRAIERLLEDPLAESLL
FT                   RGDVKPGDKIEAVETDGTETLTFLHIKDKKPARPKAPRKRTPRKPKAE"
FT                   /protein_id="YP_001876686.1"
FT   misc_feature    77984..80479
FT                   /note="ATP-dependent chaperone ClpB; Region:
FT                   chaperone_ClpB; TIGR03346"
FT                   /db_xref="CDD:163223"
FT                   /locus_tag="Amuc_0059"
FT   misc_feature    78017..78175
FT                   /note="Clp amino terminal domain; Region: Clp_N; pfam02861"
FT                   /db_xref="CDD:145814"
FT                   /locus_tag="Amuc_0059"
FT   misc_feature    78245..78400
FT                   /note="Clp amino terminal domain; Region: Clp_N; pfam02861"
FT                   /db_xref="CDD:145814"
FT                   /locus_tag="Amuc_0059"
FT   misc_feature    78608..79072
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Amuc_0059"
FT   misc_feature    78683..78706
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Amuc_0059"
FT   misc_feature    order(78686..78709,78896..78898,79007..79009)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Amuc_0059"
FT   misc_feature    78884..78901
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Amuc_0059"
FT   misc_feature    79058..79060
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Amuc_0059"
FT   misc_feature    79661..80038
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Amuc_0059"
FT   misc_feature    79694..79717
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Amuc_0059"
FT   misc_feature    order(79697..79720,79910..79912,80036..80038)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Amuc_0059"
FT   misc_feature    79898..79915
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Amuc_0059"
FT   misc_feature    80204..80440
FT                   /note="C-terminal, D2-small domain, of ClpB protein;
FT                   Region: ClpB_D2-small; pfam10431"
FT                   /db_xref="CDD:151009"
FT                   /locus_tag="Amuc_0059"
FT   gene            80688..83234
FT                   /db_xref="GeneID:6275096"
FT                   /locus_tag="Amuc_0060"
FT   CDS_pept        80688..83234
FT                   /locus_tag="Amuc_0060"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Alpha-N-acetylglucosaminidase"
FT                   /EC_number="3.2.1.50"
FT                   /note="PFAM: alpha-N-acetylglucosaminidase; KEGG:
FT                   ccr:CC_0540 alpha-N-acetylglucosaminidase"
FT                   /db_xref="GI:187734575"
FT                   /db_xref="InterPro:IPR007781"
FT                   /db_xref="GeneID:6275096"
FT                   /translation="MISSFPRILIFLMMASLHVFAEDMQKNREREAARAVIMRTVPSLA
FT                   ASPEKLHLETIEKEDGYDVFETKASGGVLTIRGSSGTALCRGFYDFLKTNRLGMVSWEN
FT                   KDIRWPAQLPDTAPRRIVSPFRNHYYFNVVTYGYTMPYWTWERWEKEIDWMALHGINMP
FT                   LALVATEGIAVRVWKQLGLTEKEIEEFYTGPAHLPWQRMGNIVNHDGPLPASWHKEQIA
FT                   LQHRILHRMKSLGMTPICPAFSGFVPRGILRLYPEAKLHRLGWGGWPQKNHAHFLSPEE
FT                   PLFLKIGRLYMQEWQKEFGKNTYFLADSFNEMELPENKGGVEARNNMLSSLGEQIYRSI
FT                   SSTNPDAVWVMQGWMFGYQRNIWNADTLKALLSKVPDDKMLLLDLAADYNKTFWRNGMN
FT                   WDVFKGFFNKPWVYSVVPNMGGKCAMTGVMDFYANGHLEALNSSSRGRLSGMGMAPEGI
FT                   ENNDVIYELITDAAWRNRQENVEQYLENYCRARYGNYPDSMKEAWNLFRRTAYSNLKDH
FT                   PRFNWQMKPGTRGCSVNTSEDFLKGLSLFVNTRGLEQSPLFRQDAVEMAVHYLGIRMNE
FT                   AIRAAQEALDEQDQENAEKCMAYFRKYALLADSLLEGHPTWRLSRWISFARSHGTSPEE
FT                   KNKYEQNARRLVTRWGPPVDDYAAKIWSGLIRDYYLPRWEHFIQSRLSEKNPDMGAWEE
FT                   KWVRSTGVSAAHAPGDLVNACRQAIREAPPLPSSLKRKAAGSIIGNWTSATVSTEWSYL
FT                   DWPVSSADLEKLRGVRFVFTSGSHALEIDGVELLENGKVIAHDRHAGLAGKPSRGNFYK
FT                   LSLPKGIHANNGCSLRARVRSVGGKSSNGKLELIKE"
FT                   /transl_table="11"
FT                   /protein_id="YP_001876687.1"
FT   sig_peptide     80688..80753
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.997 at
FT                   residue 22"
FT                   /locus_tag="Amuc_0060"
FT   misc_feature    80892..82850
FT                   /note="Alpha-N-acetylglucosaminidase (NAGLU); Region:
FT                   NAGLU; pfam05089"
FT                   /db_xref="CDD:147325"
FT                   /locus_tag="Amuc_0060"
FT   gene            84259..85335
FT                   /db_xref="GeneID:6275091"
FT                   /locus_tag="Amuc_0061"
FT                   /pseudo
FT   gene            85349..86056
FT                   /db_xref="GeneID:6275089"
FT                   /locus_tag="Amuc_0062"
FT   CDS_pept        85349..86056
FT                   /locus_tag="Amuc_0062"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rca:Rcas_1426 hypothetical protein"
FT                   /db_xref="GI:187734576"
FT                   /db_xref="InterPro:IPR004221"
FT                   /db_xref="REBASE:AmuORF61P"
FT                   /db_xref="GeneID:6275089"
FT                   /translation="MSHKIALRTQREGTIINTTSSKQEKLLRQAVKSVSMRLKKKFPGI
FT                   TLEWEPQAKLIDIIVHLRTQFPDVDFAAPSCASSMKPDGGILYMKSEDERRFPILISEK
FT                   KNQGTNDMRAKEGKKRQAQGNAIERLGKNVIGFRASMIRESIFPFVCFGDGCDFVEGSS
FT                   IRDRVITIAMFGQLNKEYVYAQGRGELFNRGSFYFREKQWTEQEMADISFSIASKAIFY
FT                   YFSRYGESTFFDN"
FT                   /protein_id="YP_001876688.1"
FT   misc_feature    85391..86008
FT                   /note="Restriction endonuclease EcoRI; Region: EcoRI;
FT                   pfam02963"
FT                   /db_xref="CDD:111811"
FT                   /locus_tag="Amuc_0062"
FT   gene            complement(86369..86710)
FT                   /db_xref="GeneID:6275087"
FT                   /locus_tag="Amuc_0063"
FT   CDS_pept        complement(86369..86710)
FT                   /locus_tag="Amuc_0063"
FT                   /gene_family="HOG000247776" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Rhodanese domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: ade:Adeh_2652
FT                   rhodanese-like protein"
FT                   /db_xref="GI:187734577"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="GeneID:6275087"
FT                   /translation="MVTGLTALFVWLKGRNAERDPASSAMVVSPEGAAARPVVLVDVRT
FT                   LDEYRTGHKEGALNIPADEVEQLAPRLLPDKNAVIMLYCRTGKRADKALEALRKMGYSH
FT                   VENLHRFEM"
FT                   /protein_id="YP_001876689.1"
FT   misc_feature    complement(86387..86605)
FT                   /note="Rhodanese Homology Domain (RHOD); an alpha beta fold
FT                   domain found duplicated in the rhodanese protein. The
FT                   cysteine containing enzymatically active version of the
FT                   domain is also found in the Cdc25 class of protein
FT                   phosphatases and a variety of proteins...; Region: RHOD;
FT                   cd00158"
FT                   /db_xref="CDD:29073"
FT                   /locus_tag="Amuc_0063"
FT   misc_feature    complement(86459..86461)
FT                   /note="active site residue"
FT                   /db_xref="CDD:29073"
FT                   /locus_tag="Amuc_0063"
FT   gene            complement(86946..87824)
FT                   /db_xref="GeneID:6275085"
FT                   /locus_tag="Amuc_0064"
FT   CDS_pept        complement(86946..87824)
FT                   /locus_tag="Amuc_0064"
FT                   /gene_family="HOG000063754" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="5-oxopent-3-ene-1,2,5-tricarboxylate
FT                   decarboxylase"
FT                   /EC_number="4.1.1.68"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   rsh:Rsph17029_1807 5-carboxymethyl-2-hydroxymuconate
FT                   delta-isomerase"
FT                   /db_xref="GI:187734578"
FT                   /db_xref="InterPro:IPR002529"
FT                   /db_xref="GeneID:6275085"
FT                   /translation="MKIRFYLNDQAERIMALWSESRGEYLAADSVLAEADACICGETGS
FT                   CGEEMKRIVAFLDSAAAKAVNPEWMIDTALPCSPSKLVCLGKSYADHAKEFDGDSVQEP
FT                   AVFLKSPSAITSCSDVVLYPPGCDKLDYEIELAVVIKDVLKNASPEEAARAISGYTLMC
FT                   DYSERANQLEHGGQWTKGKSYDSFAPMGPTFISADELGDGSGIPLELKVNGEVRQSGNT
FT                   DGLIWPVPRLIAYVSRFMTLWPGDVVSTGTPGGVGMGMKPPVYLKPGDVVEWGSPAFGF
FT                   ASQAVVIDDEG"
FT                   /transl_table="11"
FT                   /protein_id="YP_001876690.1"
FT   misc_feature    complement(87006..87584)
FT                   /note="Fumarylacetoacetate (FAA) hydrolase family; Region:
FT                   FAA_hydrolase; cl11421"
FT                   /db_xref="CDD:175247"
FT                   /locus_tag="Amuc_0064"
FT   gene            87991..89547
FT                   /db_xref="GeneID:6275083"
FT                   /locus_tag="Amuc_0065"
FT   CDS_pept        87991..89547
FT                   /locus_tag="Amuc_0065"
FT                   /gene_family="HOG000046859" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="2-isopropylmalate synthase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: 2-isopropylmalate synthase; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation) domain;
FT                   KEGG: mta:Moth_2255 2-isopropylmalate synthase"
FT                   /db_xref="GI:187734579"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="GeneID:6275083"
FT                   /translation="MSDQIYFFDTTLRDGEQCPGASMNLREKLEVARQMERLGMDVIEA
FT                   GFPCISDGDFEAVHTIAREIKKCRIAGLARCVKADIEAAAKALEPAGERARIHIFLATS
FT                   KLHMQFKLKKAESEILRMAAEGVSYAKQFVQDVEFSPEDASRTDLDFLTKVVETVIDAG
FT                   ATTVNIPDTVGYTTPDEFYRIIRHLKENVPNIGKAVISVHCHNDLGLAVANSLAAVRAG
FT                   ARQVEGTINGIGERAGNVALEEVIMALRTRAGQFGDVTDNINTKEIVRTSRIVARMSGM
FT                   QVQRSKAIVGENAFAHSSGIHQHGILNCRETYEVMDPQAVGWGATELPLTKHSGRAAVK
FT                   SRLEQLGHVLTEEEVNTVFERFKKVGDSKKFVYDDDLSAIVDDSLHASTGLWELDFLQF
FT                   VAGSHARPTATVGLLKEGKKFEDSSTGNGAVDAVIKAIERITRRKGTLKGYSVNAASEG
FT                   KDALGEVTVHVDFGQPKPIVGKGASTDVIEASARAYLNAVNRSIRMENMPQPNNLDAGT
FT                   I"
FT                   /protein_id="YP_001876691.1"
FT   misc_feature    87991..89505
FT                   /note="2-isopropylmalate synthase; Validated; Region:
FT                   PRK00915"
FT                   /db_xref="CDD:167101"
FT                   /locus_tag="Amuc_0065"
FT   misc_feature    88009..88821
FT                   /note="2-isopropylmalate synthase (IPMS), N-terminal
FT                   catalytic TIM barrel domain; Region: DRE_TIM_IPMS; cd07940"
FT                   /db_xref="CDD:163678"
FT                   /locus_tag="Amuc_0065"
FT   misc_feature    order(88027..88032,88039..88041,88120..88122,88213..88215,
FT                   88282..88284,88408..88410,88414..88416,88498..88500,
FT                   88504..88506,88597..88599,88603..88605)
FT                   /note="active site"
FT                   /db_xref="CDD:163678"
FT                   /locus_tag="Amuc_0065"
FT   misc_feature    order(88027..88032,88120..88122)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:163678"
FT                   /locus_tag="Amuc_0065"
FT   misc_feature    order(88597..88599,88603..88605)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:163678"
FT                   /locus_tag="Amuc_0065"
FT   misc_feature    89164..89496
FT                   /note="LeuA allosteric (dimerization) domain; Region:
FT                   LeuA_dimer; pfam08502"
FT                   /db_xref="CDD:149524"
FT                   /locus_tag="Amuc_0065"
FT   gene            89669..90583
FT                   /db_xref="GeneID:6275076"
FT                   /locus_tag="Amuc_0066"
FT   CDS_pept        89669..90583
FT                   /locus_tag="Amuc_0066"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative ATP/GTP-binding protein"
FT                   /transl_table="11"
FT                   /note="KEGG: fps:FP1581 putative ATP/GTP-binding protein"
FT                   /db_xref="GI:187734580"
FT                   /db_xref="GeneID:6275076"
FT                   /translation="MKATLLLLCLACSALAAPPTKKQPAPVEPLPALEKNTIAIDGHPE
FT                   SVAADAEGNIYFTCIGSRLTPTEKDKDGYLGVIPHGSTEPKKITDVDTLDAPKGLLYQD
FT                   GFLYCTDVDMVFKINAKTGAIEGYVDLSPSRMKFLNDLAFINGRLMVSSTDTNQIFYVD
FT                   TNTSSYGELVTKQPIYKPNGLAWDPERKVIYLCEYATDEKGKPSGRLLSINPVSREVTE
FT                   LSKERGQYDGLVYRDNALYYSDWSKDKKPEAVRRLDLKTGRSAPVATGPVEGAADFILY
FT                   DSMMVVPGMTEKKIHIMPIGGKK"
FT                   /protein_id="YP_001876692.1"
FT   sig_peptide     89669..89719
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.942 at
FT                   residue 17"
FT                   /locus_tag="Amuc_0066"
FT   misc_feature    89969..90442
FT                   /note="SMP-30/Gluconolaconase/LRE-like region; Region: SGL;
FT                   pfam08450"
FT                   /db_xref="CDD:149490"
FT                   /locus_tag="Amuc_0066"
FT   gene            90682..91158
FT                   /db_xref="GeneID:6275074"
FT                   /locus_tag="Amuc_0067"
FT   CDS_pept        90682..91158
FT                   /locus_tag="Amuc_0067"
FT                   /gene_family="HOG000015154" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GatB/YqeY domain protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dvl:Dvul_1367 GatB/YqeY domain protein"
FT                   /db_xref="GI:187734581"
FT                   /db_xref="GeneID:6275074"
FT                   /translation="MRLVNGDMNTISDQIMEGMKTAMKAKDSVTLNTLRALKTALTNTA
FT                   IAKGGLGTRLEEAEELAVVRKQIKQREDSAEQFRAAGRPELAEKEEAEITVLKQFMPAE
FT                   LTAEETAAILETVMKETGASAKKDMGQVMKLMQERTAGRVNGKELARMVSARLS"
FT                   /protein_id="YP_001876693.1"
FT   misc_feature    90718..91152
FT                   /note="GatB domain; Region: GatB_Yqey; cl11497"
FT                   /db_xref="CDD:159498"
FT                   /locus_tag="Amuc_0067"
FT   gene            91155..91850
FT                   /db_xref="GeneID:6275071"
FT                   /locus_tag="Amuc_0068"
FT   CDS_pept        91155..91850
FT                   /locus_tag="Amuc_0068"
FT                   /gene_family="HOG000218563" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase; PFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol synthase; KEGG:
FT                   cth:Cthe_2941 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="GI:187734582"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="GeneID:6275071"
FT                   /translation="MKCCAAIIVAAGSSRRAGFDKLLAPLHGVRVLERSIRAFANCREI
FT                   TEIVVVCPEERFHAINGANLETEIPVTRVDGGAERHESVQNGLAALLYTPEFVAVHDGA
FT                   RPLITVEQISRCIQTAREYGASASAHPVTDTLKRADKEHFTLPEQVERDGLWCMETPQV
FT                   FQYPLLLDAYVEVTERNIQVTDEVTALQLIGHPTRLVHNHEPNPKITWPEDISRAEMLM
FT                   ELKHLRNDS"
FT                   /protein_id="YP_001876694.1"
FT   misc_feature    91164..91808
FT                   /note="CDP-ME synthetase is involved in
FT                   mevalonate-independent isoprenoid production; Region:
FT                   CDP-ME_synthetase; cd02516"
FT                   /db_xref="CDD:133009"
FT                   /locus_tag="Amuc_0068"
FT   misc_feature    order(91179..91181,91185..91202,91215..91217,91383..91394,
FT                   91401..91403,91458..91466,91776..91778)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:133009"
FT                   /locus_tag="Amuc_0068"
FT   misc_feature    order(91467..91469,91524..91526,91548..91550,91554..91556,
FT                   91611..91628,91704..91709,91713..91718,91725..91727,
FT                   91740..91751,91761..91766)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:133009"
FT                   /locus_tag="Amuc_0068"
FT   gene            91847..92701
FT                   /db_xref="GeneID:6275069"
FT                   /locus_tag="Amuc_0069"
FT   CDS_pept        91847..92701
FT                   /locus_tag="Amuc_0069"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /transl_table="11"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; KEGG: art:Arth_0902
FT                   NAD-dependent epimerase/dehydratase"
FT                   /db_xref="GI:187734583"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR002225"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="GeneID:6275069"
FT                   /translation="MTGLLCKNPRIVLILGTGYLGKALAESLRKAGHTALTADIDPQKA
FT                   IYEADVADQASMQGLAARIPSPQIIVMCASTRGGGEEAYRNLYAHGTRNTLEAFSGTPV
FT                   IFCSSTAVYGITDGRWITEEHNVYPSSGKNGLLIQAEQAVLAAGGTVVRLGALYGPGRC
FT                   VLVSQYVTKGKALPGAMNRWLNYIHRDDAAAALHLLCTLREPPAGIYNLTDRTPMQMGE
FT                   IYSYLSNLLGKPAPQPEPLPAEARRGFSNQRISCSRLLALGWEPLYPSFADGVHNVLEA
FT                   LEE"
FT                   /protein_id="YP_001876695.1"
FT   misc_feature    91874..92698
FT                   /note="Nucleoside-diphosphate-sugar epimerases [Cell
FT                   envelope biogenesis, outer membrane / Carbohydrate
FT                   transport and metabolism]; Region: WcaG; COG0451"
FT                   /db_xref="CDD:30800"
FT                   /locus_tag="Amuc_0069"
FT   misc_feature    <91874..>92077
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="Amuc_0069"
FT   gene            92893..93858
FT                   /db_xref="GeneID:6275067"
FT                   /locus_tag="Amuc_0070"
FT   CDS_pept        92893..93858
FT                   /locus_tag="Amuc_0070"
FT                   /gene_family="HOG000059939" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="KEGG: rba:RB6436 tryptophanyl-tRNA synthetase;
FT                   TIGRFAM: tryptophanyl-tRNA synthetase; PFAM: aminoacyl-tRNA
FT                   synthetase class Ib"
FT                   /db_xref="GI:187734584"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="GeneID:6275067"
FT                   /translation="MRIITGLQPSGKLHVGNYFGAMEPAVRMQESGESFYFLADYHAMS
FT                   TVHDANALRENCSNLATDFLAVGLDPEKCVFFRQSAVPEVNELAWILSTVCPMGLLERC
FT                   HSYKDKIAKGFSPSNALFTYPVLMAADILMYDSDLVPVGKDQKQHLEVTRDLAGKMNEQ
FT                   FGEGTCKLPDALIAESTAIVPGLDGQKMSKSYNNTLPIFGEEKAVRKLIMRIPTDSTPV
FT                   EDPKPTEGSVILQLYKLFASAQGYEDMVRGFQNGGCGYGDFKKRLFDAYWEYFRPARER
FT                   RAELEANQDYVRRTLEEGARKARETASVVLDRVRRAVGLA"
FT                   /transl_table="11"
FT                   /protein_id="YP_001876696.1"
FT   misc_feature    92896..93714
FT                   /note="catalytic core domain of tryptophanyl-tRNA
FT                   synthetase; Region: TrpRS_core; cd00806"
FT                   /db_xref="CDD:173903"
FT                   /locus_tag="Amuc_0070"
FT   misc_feature    92899..93852
FT                   /note="tryptophanyl-tRNA synthetase II; Reviewed; Region:
FT                   PRK12282"
FT                   /db_xref="CDD:171365"
FT                   /locus_tag="Amuc_0070"
FT   misc_feature    order(92902..92916,92932..92934,92938..92943,92950..92952,
FT                   93001..93003,93016..93018,93127..93129,93262..93264,
FT                   93274..93276,93283..93285,93310..93312,93316..93321,
FT                   93325..93330,93337..93339,93433..93435,93460..93465,
FT                   93469..93471)
FT                   /note="active site"
FT                   /db_xref="CDD:173903"
FT                   /locus_tag="Amuc_0070"
FT   misc_feature    92932..92943
FT                   /note="HIGH motif; other site"
FT                   /db_xref="CDD:173903"
FT                   /locus_tag="Amuc_0070"
FT   misc_feature    order(93013..93015,93022..93027,93145..93150,93154..93162,
FT                   93169..93174,93178..93189,93193..93198,93250..93252,
FT                   93256..93261,93268..93273)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:173903"
FT                   /locus_tag="Amuc_0070"
FT   misc_feature    93460..93474
FT                   /note="KMSKS motif; other site"
FT                   /db_xref="CDD:173903"
FT                   /locus_tag="Amuc_0070"
FT   gene            93947..94417
FT                   /db_xref="GeneID:6275065"
FT                   /locus_tag="Amuc_0071"
FT   CDS_pept        93947..94417
FT                   /locus_tag="Amuc_0071"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="UspA domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: UspA domain protein; KEGG: sru:SRU_1737
FT                   universal stress protein family"
FT                   /db_xref="GI:187734585"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="GeneID:6275065"
FT                   /translation="MKNILVAIDFSNATDAVIHQIGKLACPNDSIIHLLHIVEPSICYE
FT                   VSGVLPDEVPVPVMDQTEENEVISIAKNHLKQTAEKLSRLTDATIIQAVEDEFEISEAV
FT                   INYAEKHHIDMIVVGKHNHGFLSTVFLGSVASSVMRKSPVPVLVVPVTREEQ"
FT                   /protein_id="YP_001876697.1"
FT   misc_feature    93953..94393
FT                   /note="Usp: Universal stress protein family. The universal
FT                   stress protein Usp is a small cytoplasmic bacterial protein
FT                   whose expression is enhanced when the cell is exposed to
FT                   stress agents. Usp enhances the rate of cell survival
FT                   during prolonged exposure to...; Region: USP_Like; cd00293"
FT                   /db_xref="CDD:30165"
FT                   /locus_tag="Amuc_0071"
FT   misc_feature    order(93965..93973,94055..94057,94298..94303,94307..94312,
FT                   94340..94351)
FT                   /note="Ligand Binding Site; other site"
FT                   /db_xref="CDD:30165"
FT                   /locus_tag="Amuc_0071"
FT   gene            94451..95254
FT                   /db_xref="GeneID:6275063"
FT                   /locus_tag="Amuc_0072"
FT   CDS_pept        94451..95254
FT                   /locus_tag="Amuc_0072"
FT                   /gene_family="HOG000011009" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="metallophosphoesterase"
FT                   /transl_table="11"
FT                   /note="PFAM: metallophosphoesterase; KEGG: tte:TTE1371
FT                   hypothetical protein"
FT                   /db_xref="GI:187734586"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR005235"
FT                   /db_xref="GeneID:6275063"
FT                   /translation="MITILFIGDVVGEPGRTAVKHMLPELKREHGADFIIVNGENAAAG
FT                   RGITPRLAQELLHAGVDVITTGDHVWDQAELAPWMESEPRVLRPVNYPQGTPGHGSVVV
FT                   ETPKGKIAVMQVQGRSFIQPPLENPFLISEAEAKRLREEKGVRVIFVDMHAETTSEKIS
FT                   TGYNLDGLVSAVVGTHTHVQTADETILERGTAYLTDAGMCGPAVGVLGREREPILQRFR
FT                   TSMPAKFPVANWPVRLCGAVVQIDEATGRALSIARINKIVEKPAS"
FT                   /protein_id="YP_001876698.1"
FT   misc_feature    94454..94999
FT                   /note="Calcineurin-like phosphoesterase; Region:
FT                   Metallophos; pfam00149"
FT                   /db_xref="CDD:143917"
FT                   /locus_tag="Amuc_0072"
FT   misc_feature    94460..95230
FT                   /note="Deinococcus radiodurans DR1281 and related proteins,
FT                   metallophosphatase domain; Region: MPP_DR1281; cd07382"
FT                   /db_xref="CDD:163625"
FT                   /locus_tag="Amuc_0072"
FT   misc_feature    order(94475..94477,94481..94483,94568..94573,94652..94657,
FT                   94910..94912,94985..94987,94991..94993)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:163625"
FT                   /locus_tag="Amuc_0072"
FT   misc_feature    order(94475..94477,94568..94573,94652..94654,94910..94912,
FT                   94985..94987,94991..94993)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:163625"
FT                   /locus_tag="Amuc_0072"
FT   misc_feature    order(94805..94807,94811..94813,94832..94834,94838..94843,
FT                   94850..94852,94916..94918,94922..94930,94934..94939,
FT                   94946..94951,94988..94990,94994..95008,95012..95014,
FT                   95042..95044,95072..95080,95090..95092,95102..95104,
FT                   95111..95116,95219..95221,95225..95227)
FT                   /note="homodimer binding site; other site"
FT                   /db_xref="CDD:163625"
FT                   /locus_tag="Amuc_0072"
FT   gene            95579..96373
FT                   /db_xref="GeneID:6275061"
FT                   /locus_tag="Amuc_0073"
FT   CDS_pept        95579..96373
FT                   /locus_tag="Amuc_0073"
FT                   /gene_family="HOG000263839" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein; KEGG:
FT                   yen:YE3305 hypothetical protein"
FT                   /db_xref="GI:187734587"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="GeneID:6275061"
FT                   /translation="MNYEARFGGIGRLYGNSGLSLLRSARIAVVGIGGVGSWAAEALAR
FT                   SGVGTIILMDMDDLCITNTNRQIHALASTIGQSKTETMATRIREINPEAEVIPISNFYT
FT                   ASNAEKLLSAEPDVIIDAIDSLIPKAHLIASCYRGKQPLVTCGGAGGRINPARIEIDDL
FT                   SRTRGDPLLSSLRYRLKKDYALPLGEKARKLKIPCVFSQETPVYPTCDGKTSCTRDPEF
FT                   QGKTGCDAGFGSVTHITGTFGFFAASAAIQMLLNKKKTPSSS"
FT                   /protein_id="YP_001876699.1"
FT   misc_feature    95582..96361
FT                   /note="Dinucleotide-utilizing enzymes involved in
FT                   molybdopterin and thiamine biosynthesis family 1 [Coenzyme
FT                   metabolism]; Region: COG1179"
FT                   /db_xref="CDD:31372"
FT                   /locus_tag="Amuc_0073"
FT   misc_feature    95618..96292
FT                   /note="Family of activating enzymes (E1) of ubiquitin-like
FT                   proteins related to the E.coli hypothetical protein ygdL.
FT                   The common reaction mechanism catalyzed by E1-like enzymes
FT                   begins with a nucleophilic attack of the C-terminal
FT                   carboxylate of the ubiquitin...; Region: YgdL_like;
FT                   cd00755"
FT                   /db_xref="CDD:30110"
FT                   /locus_tag="Amuc_0073"
FT   misc_feature    order(95669..95671,95675..95677,95681..95683,95741..95743,
FT                   95747..95749,95774..95776,95813..95815,95942..95944,
FT                   95960..95962)
FT                   /note="putative ATP binding site; other site"
FT                   /db_xref="CDD:30110"
FT                   /locus_tag="Amuc_0073"
FT   misc_feature    order(95681..95683,95963..95965,96017..96022,96038..96040)
FT                   /note="putative substrate interface; other site"
FT                   /db_xref="CDD:30110"
FT                   /locus_tag="Amuc_0073"
FT   gene            96370..96885
FT                   /db_xref="GeneID:6275058"
FT                   /locus_tag="Amuc_0074"
FT   CDS_pept        96370..96885
FT                   /locus_tag="Amuc_0074"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:187734588"
FT                   /db_xref="GeneID:6275058"
FT                   /translation="MNKLLLSLLGAALLPALTQCNTLEKDIAGINARNAEIACEPRGNY
FT                   FVGRRYHVPATRFWGYLRQPGQTWRTAQLVIMDESACRTPDRLPEYTGNPRYAYDNNYE
FT                   YRVYGKYTGKYGYEPNSNLKLPIFKPTRFEVANANPGWLFKPSEKYDTGAVTLRPAIMP
FT                   ATTSLPVR"
FT                   /protein_id="YP_001876700.1"
FT   sig_peptide     96370..96438
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.407 at
FT                   residue 23"
FT                   /locus_tag="Amuc_0074"
FT   gene            96989..97074
FT                   /note="tRNA-Leu1"
FT                   /db_xref="GeneID:6275056"
FT                   /locus_tag="Amuc_R0006"
FT   tRNA            96989..97074
FT                   /db_xref="GeneID:6275056"
FT                   /locus_tag="Amuc_R0006"
FT                   /product="tRNA-Leu"
FT   gene            complement(97286..98353)
FT                   /db_xref="GeneID:6275052"
FT                   /locus_tag="Amuc_0075"
FT   CDS_pept        complement(97286..98353)
FT                   /locus_tag="Amuc_0075"
FT                   /gene_family="HOG000235951" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="PfkB domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: PfkB domain protein; KEGG: tex:Teth514_1119
FT                   PfkB domain protein"
FT                   /db_xref="GI:187734589"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="GeneID:6275052"
FT                   /translation="MNLFFLFPQGRRVLCFFISPGLYFAGRFTFNICKSMYDVVALGEL
FT                   LIDFTPCGINDRELPVYQANPGGAPCNVLSMLSRLGRKTSFIGKVGHDMFGKMLRRTLQ
FT                   EEGIGDSGLVASREVNTTLAFVQIDEHGDREFSFYRNPGADMKLTAGEVALELVEHARV
FT                   FHFGTISMTHDDVRRATRHAVSHARKKGALISFDPNLRPPLWPDMELAREQMLYGCGAC
FT                   SVMKIEMEELLFLTGCATMEEGLRILQREFDNLRLILVTGGRKGSWAAYESKLIHQPTY
FT                   LNVKTIDTTGAGDAFLGCCLDRILETGLENLTEGQLADMLLFANAAASIVTTRKGAIRS
FT                   MPSREEAVALMAEGF"
FT                   /protein_id="YP_001876701.1"
FT   misc_feature    complement(97340..98242)
FT                   /note="Fructokinases (FRKs) mainly from bacteria and plants
FT                   are enzymes with high specificity for fructose, as are all
FT                   FRKs, but they catalyzes the conversion of fructose to
FT                   fructose-6-phosphate, which is an entry point into
FT                   glycolysis via conversion into...; Region: bac_FRK;
FT                   cd01167"
FT                   /db_xref="CDD:29351"
FT                   /locus_tag="Amuc_0075"
FT   misc_feature    complement(97298..98212)
FT                   /note="Fructose-1-phosphate kinase and related
FT                   fructose-6-phosphate kinase (PfkB) [Carbohydrate transport
FT                   and metabolism]; Region: FruK; COG1105"
FT                   /db_xref="CDD:31302"
FT                   /locus_tag="Amuc_0075"
FT   misc_feature    complement(order(97472..97474,97481..97483,98138..98140))
FT                   /note="putative substrate binding site; other site"
FT                   /db_xref="CDD:29351"
FT                   /locus_tag="Amuc_0075"
FT   misc_feature    complement(order(97466..97468,97475..97480,97487..97489,
FT                   97571..97573,97670..97672))
FT                   /note="putative ATP binding site; other site"
FT                   /db_xref="CDD:29351"
FT                   /locus_tag="Amuc_0075"
FT   gene            98743..99246
FT                   /db_xref="GeneID:6275049"
FT                   /locus_tag="Amuc_0076"
FT   CDS_pept        98743..99246
FT                   /locus_tag="Amuc_0076"
FT                   /gene_family="HOG000261970" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NUDIX hydrolase"
FT                   /transl_table="11"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: spu:587752 similar to
FT                   8-oxo-dGTPase"
FT                   /db_xref="GI:187734590"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003563"
FT                   /db_xref="GeneID:6275049"
FT                   /translation="MQEKSSGFQWPAQWTPDILATLMFVVQKGRILLIRKKRGIGAGKV
FT                   NGPGGKFEPGETALQCVLREVREELHIDIEDAREMGVLNFSFACGTIPEIRCHVFMATS
FT                   FTGTPTETPEAEPFWCPVDGIPYDLMWQDDRFWLPAMLDGKRFEAFFTFEGDRMLEFSL
FT                   KAED"
FT                   /protein_id="YP_001876702.1"
FT   misc_feature    98794..99204
FT                   /note="MutT homolog-1 (MTH1) is a member of the Nudix
FT                   hydrolase superfamily. MTH1, the mammalian counterpart of
FT                   MutT, hydrolyzes oxidized purine nucleoside triphosphates,
FT                   such as 8-oxo-dGTP and 2-hydroxy-ATP, to monophosphates,
FT                   thereby preventing the...; Region: MTH1; cd03427"
FT                   /db_xref="CDD:72885"
FT                   /locus_tag="Amuc_0076"
FT   misc_feature    order(98794..98796,98800..98802,98806..98808,98878..98880,
FT                   98893..98895,98932..98937,98944..98949,98995..98997,
FT                   99025..99027,99031..99033,99079..99084,99133..99135,
FT                   99139..99141)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:72885"
FT                   /locus_tag="Amuc_0076"
FT   misc_feature    order(98794..98796,98800..98802,98806..98808,98878..98880,
FT                   98893..98895,98932..98937,98944..98949,98995..98997,
FT                   99025..99027,99031..99033,99133..99135,99139..99141)
FT                   /note="nucleotide binding site; other site"
FT                   /db_xref="CDD:72885"
FT                   /locus_tag="Amuc_0076"
FT   misc_feature    98890..98958
FT                   /note="nudix motif; other site"
FT                   /db_xref="CDD:72885"
FT                   /locus_tag="Amuc_0076"
FT   misc_feature    99079..99084
FT                   /note="putative metal binding site; other site"
FT                   /db_xref="CDD:72885"
FT                   /locus_tag="Amuc_0076"
FT   gene            100094..101293
FT                   /db_xref="GeneID:6275047"
FT                   /locus_tag="Amuc_0077"
FT   CDS_pept        100094..101293
FT                   /locus_tag="Amuc_0077"
FT                   /gene_family="HOG000221022" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="2-amino-3-ketobutyrate coenzyme A ligase"
FT                   /transl_table="11"
FT                   /note="catalyzes the formation of 2-amino-3-oxobutanoate
FT                   from acetyl-CoA and glycine"
FT                   /db_xref="GI:187734591"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR011282"
FT                   /db_xref="GeneID:6275047"
FT                   /translation="MYTPEFKNILTSTLDGLRAEGLYKEERFIASQQYSQVTLKDGRSV
FT                   INMCANNYLGLANNPEVMEAAKKAIDQWGFGMASVRFICGTQTLHRQLEERLTQFLGTE
FT                   DTILFPSCFDANGGLFEGLLTADDAIISDSLNHASIIDGVRLCKAKRFRYANNDMADLE
FT                   AKLQEADAAGARVKLISTDGVFSMDGIIAQLDKIHELAAKYNAIVHFDDCHATGFLGEK
FT                   GRGTHEYRGLFGHIDITTGTLGKALGGASGGYVSGPKEVVDVLRQKARPYLFSNSVAPA
FT                   IVAASIKVLDLLEQSTEARDRVEANTKYFRDAMTGAGFTIGGKDHPISPVMLGDAVLSQ
FT                   KFSAQLLDEGVYAVGFFYPVVPKGQARIRTQISAAHTREQLDKAIEAFCKVGKNLGVIS
FT                   "
FT                   /protein_id="YP_001876703.1"
FT   misc_feature    100121..101287
FT                   /note="pyridoxal phosphate-dependent acyltransferase,
FT                   putative; Region: gly_Cac_T_rel; TIGR01825"
FT                   /db_xref="CDD:130884"
FT                   /locus_tag="Amuc_0077"
FT   misc_feature    100220..101269
FT                   /note="KBL_like; this family belongs to the pyridoxal
FT                   phosphate (PLP)-dependent aspartate aminotransferase
FT                   superfamily (fold I). The major groups in this CD
FT                   corresponds to serine palmitoyltransferase (SPT),
FT                   5-aminolevulinate synthase (ALAS), 8-amino-7-...; Region:
FT                   KBL_like; cd06454"
FT                   /db_xref="CDD:99747"
FT                   /locus_tag="Amuc_0077"
FT   misc_feature    order(100244..100246,100424..100432,100502..100504,
FT                   100637..100639,100649..100654,100724..100726,
FT                   100730..100735,100820..100822,100829..100831,
FT                   101198..101200)
FT                   /note="substrate-cofactor binding pocket; other site"
FT                   /db_xref="CDD:99747"
FT                   /locus_tag="Amuc_0077"
FT   misc_feature    order(100424..100432,100502..100504,100637..100639,
FT                   100649..100651,100724..100726,100730..100735,
FT                   100820..100822,100829..100831)
FT                   /note="pyridoxal 5'-phosphate binding site; other site"
FT                   /db_xref="CDD:99747"
FT                   /locus_tag="Amuc_0077"
FT   misc_feature    100829..100831
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99747"
FT                   /locus_tag="Amuc_0077"
FT   gene            101329..103947
FT                   /db_xref="GeneID:6275041"
FT                   /locus_tag="Amuc_0078"
FT   CDS_pept        101329..103947
FT                   /locus_tag="Amuc_0078"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="serine/threonine protein kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF323; PEGA
FT                   domain protein; SMART: tyrosine protein kinase;
FT                   serine/threonine protein kinase; KEGG: ilo:IL2186 secreted
FT                   protein with uncharacterized domain"
FT                   /db_xref="GI:187734592"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR013229"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="GeneID:6275041"
FT                   /translation="MPGGNLPTLPVKRVVRPTPSIPDHEVVRQIGSGAYGEVWLAKSLT
FT                   GAWRAVKIVWREDFEDERSFNREFEGILQYEPIARNHPGLVHILHVGRHDQDSPFYYYV
FT                   MELGDDARTGVHITPDEYIPRTLQTDKKFSGNKPLPLDYCLEVGSQLAHALLYLHSKNL
FT                   THRDIKPANVIFVNGRPKLADIGLVAHLDQRSFVGTEGFIPPDGPGTRRADVYALAKVL
FT                   YEISTGKDRMDFPELPDDLPEGTVRKKWQAFNTIICQAAEPRIEECSIDSAEELAEKID
FT                   ALRGYEVPSRFRLQKKKKRRKLRRALQLLAAAAAGALTAYWGALWLNNSQHPPEEPASD
FT                   IHPDIHSSAPEEESRTGYVLVTSSPAGASVYDADGNYLDETPYGPIELPSGSPVAYTIK
FT                   KSGFADKEEAGTVKGGSTLALGGVLKEYHPPTDSQPWKDTEGVTYLPAETRHVAQGPLT
FT                   AALFNKFLKEDRQKGNFQMKREQTEPGHPEKDVALLTQDGITAYLAWLNKKCEREGLLG
FT                   KEFSINADPLPQASGSTENHNAYVLNVTRVFQVPITVTTNPPGASVFFNNRLIGRTPIE
FT                   EYVNQVPYVIEIKLPGHATMRRRGLDPQDLYLSLQLEPDKSVVFGSPWTNSLGIKLVPV
FT                   GGNALVMTHEVRVKDFQEFLKATGRKAPARPGFPQGEDHPVVNVSRQDARAFARWLTSK
FT                   ERALGLIDQHDSYRLPKDEEWSSWVRLTDEQGASPYEKTLPHENSREAFPWGYSWPPPD
FT                   KTGNFADQSALIYLPSSRVIVGYNDGQPYTAPVKTFPPNHLGLYDLEGNVMEWVDDSYG
FT                   GPESLPIRNYGVARGGSYLSFRPKQLTTSIRTPLPENTRDNALGFRLILSSERPAIPTA
FT                   P"
FT                   /protein_id="YP_001876704.1"
FT   misc_feature    101416..102039
FT                   /note="Catalytic domain of Protein Kinases; Region: PKc;
FT                   cd00180"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="Amuc_0078"
FT   misc_feature    order(101416..101430,101440..101442,101476..101478,
FT                   101482..101484,101584..101586,101641..101652,
FT                   101704..101706,101710..101712,101827..101829,
FT                   101833..101835,101839..101844,101848..101850,
FT                   101878..101880,101887..101889,101920..101931)
FT                   /note="active site"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="Amuc_0078"
FT   misc_feature    order(101416..101430,101440..101442,101476..101478,
FT                   101482..101484,101584..101586,101641..101652,
FT                   101704..101706,101827..101829,101833..101835,
FT                   101839..101844,101848..101850,101878..101880)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="Amuc_0078"
FT   misc_feature    order(101428..101430,101704..101706,101710..101712,
FT                   101827..101829,101833..101835,101839..101841,
FT                   101887..101889,101920..101931)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="Amuc_0078"
FT   misc_feature    order(101875..101895,101920..101931)
FT                   /note="activation loop (A-loop); other site"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="Amuc_0078"
FT   misc_feature    102394..102606
FT                   /note="PEGA domain; Region: PEGA; pfam08308"
FT                   /db_xref="CDD:116891"
FT                   /locus_tag="Amuc_0078"
FT   misc_feature    102982..103170
FT                   /note="PEGA domain; Region: PEGA; pfam08308"
FT                   /db_xref="CDD:116891"
FT                   /locus_tag="Amuc_0078"
FT   misc_feature    103249..103908
FT                   /note="Formylglycine-generating sulfatase enzyme; Region:
FT                   FGE-sulfatase; cl00556"
FT                   /db_xref="CDD:163873"
FT                   /locus_tag="Amuc_0078"
FT   gene            104109..104879
FT                   /db_xref="GeneID:6275038"
FT                   /locus_tag="Amuc_0079"
FT   CDS_pept        104109..104879
FT                   /locus_tag="Amuc_0079"
FT                   /gene_family="HOG000019422" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /transl_table="11"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   sth:STH3333 ParA, ParA family ATPase"
FT                   /db_xref="GI:187734593"
FT                   /db_xref="InterPro:IPR000392"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="GeneID:6275038"
FT                   /translation="MKIIAIANQKGGVGKTTTAINMAAALAQLKKKILVIDLDPQANAT
FT                   SGMGIDGKDMPSLYPALLGQLPAEECILPSGRKRLDIIPSTMDLAGVEIELARSGNHLT
FT                   RLRETLAPLRESDTYDYCIMDTPPSLGVLMTSALAACDEVLTPLQCEWFGLEGLAKILH
FT                   VTAQICASGANPRIRHEGVLMTMYDGRTNLSRQVIDQVERHLPQMLYKTVIPRSIRLGE
FT                   APSFGHTIFEHDPSGAAADAYLKAAREFIKRHKP"
FT                   /protein_id="YP_001876705.1"
FT   misc_feature    104109..104867
FT                   /note="ATPases involved in chromosome partitioning [Cell
FT                   division and chromosome partitioning]; Region: Soj;
FT                   COG1192"
FT                   /db_xref="CDD:31385"
FT                   /locus_tag="Amuc_0079"
FT   misc_feature    104115..>104231
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Amuc_0079"
FT   misc_feature    104136..104156
FT                   /note="P-loop; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Amuc_0079"
FT   misc_feature    104154..104156
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Amuc_0079"
FT   misc_feature    <104463..104663
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Amuc_0079"
FT   misc_feature    104481..104483
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Amuc_0079"
FT   gene            105086..107872
FT                   /db_xref="GeneID:6275036"
FT                   /locus_tag="Amuc_0080"
FT   CDS_pept        105086..107872
FT                   /locus_tag="Amuc_0080"
FT                   /gene_family="HOG000062007" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="serine/threonine protein kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   SMART: tyrosine protein kinase; serine/threonine protein
FT                   kinase; KEGG: mgm:Mmc1_1921 serine/threonine protein
FT                   kinase"
FT                   /db_xref="GI:187734594"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="GeneID:6275036"
FT                   /translation="MLQLRFRNFPLMPAEEGQPDDQPRVTGQVPPPAPTTGLEQILPGR
FT                   PPLPHAEEKGAFFVYQRELAPGTRLEQYEIIRVLGSGGFGITYLAKDLFLNRNVVIKEN
FT                   FPSRYSYRDPLTGHIRPNNEHDLENYTWALKSFLSEAQTLAELNNPGIVRILSVFEANG
FT                   TAYFAMEHITGLSLDYLGEKLHSTGHRYTEDELKGLLTRLLRILDYLHSRHIYHRDIKP
FT                   GNILLTEEGTPVLIDFGAARHALKLHAATVLTTQGYSSPEQALGKTNIGPWSDLYSVGA
FT                   TFYALLTGNPPDRAEARLAEDEMQPLHSDPVLTRYYSRQFLLSLDKALAPQINCRYQTA
FT                   GEWIHDICAISGEESSATIQVLPADLRHAHPEGMPTPGAGKNIGSRKAATGTDGLHSAS
FT                   RRQSARALRRNRHMMSLLVGSACTILLGAGAFYLLDYMKKAPMGTTINTIKEAIQQPAA
FT                   SSNVGEPEPPPRDLASIRIPELKITEDAALEPRSLTEFRLRLDDTILTRSGLPPILPEK
FT                   LRISCIYLQIIPPAANGEKLYLTIRDSNGVLVDRSINAVPSFTVPGQSTSTFFFPALPE
FT                   LSTDRTYTYSFENAAHQAVPMQMACFKNETKRTEEAFPKIRFIAAPPVPEPALLHDPAY
FT                   KNLVAAIAAPSPENKNILDQASSMPGMLPALEQLSKAGYPIAQQALGKTLMSPDCPGGS
FT                   RPEEGVEWLYRSATGGCYEAMKELGILLMDIPSYFPRLPQQPPLASRDYAQATRFLRMA
FT                   VQYRDQEALYLLSLMYSQGWGVPASPELSSLMMERLNGSSYSTDSLNPNAPIAAYWLPL
FT                   PLAGEKNTILRFTIPGPFAPSQLKGVTLHNTSLKDAFSISKINILQHGRLILDIISPQE
FT                   VLPGKSSAPIGISIPEGLLADTTLPLEVEILLTPGNSCGVVEMPPPVEKKNSGIEIN"
FT                   /protein_id="YP_001876706.1"
FT   misc_feature    105320..105943
FT                   /note="Catalytic domain of Protein Kinases; Region: PKc;
FT                   cd00180"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="Amuc_0080"
FT   misc_feature    order(105320..105334,105344..105346,105383..105385,
FT                   105389..105391,105542..105544,105590..105601,
FT                   105611..105613,105740..105742,105746..105748,
FT                   105752..105757,105761..105763,105794..105796,
FT                   105803..105805,105845..105856)
FT                   /note="active site"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="Amuc_0080"
FT   misc_feature    order(105320..105334,105344..105346,105383..105385,
FT                   105389..105391,105542..105544,105590..105601,
FT                   105611..105613,105740..105742,105746..105748,
FT                   105752..105757,105761..105763,105794..105796)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="Amuc_0080"
FT   misc_feature    105332..106111
FT                   /note="Serine/Threonine protein kinases, catalytic domain;
FT                   Region: S_TKc; smart00220"
FT                   /db_xref="CDD:128516"
FT                   /locus_tag="Amuc_0080"
FT   misc_feature    order(105332..105334,105611..105613,105740..105742,
FT                   105746..105748,105752..105754,105803..105805,
FT                   105845..105856)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="Amuc_0080"
FT   misc_feature    order(105791..105811,105845..105856)
FT                   /note="activation loop (A-loop); other site"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="Amuc_0080"
FT   misc_feature    <106967..107428
FT                   /note="FOG: TPR repeat, SEL1 subfamily [General function
FT                   prediction only]; Region: COG0790"
FT                   /db_xref="CDD:31133"
FT                   /locus_tag="Amuc_0080"
FT   gene            107958..108536
FT                   /db_xref="GeneID:6275034"
FT                   /locus_tag="Amuc_0081"
FT   CDS_pept        107958..108536
FT                   /locus_tag="Amuc_0081"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:187734595"
FT                   /db_xref="GeneID:6275034"
FT                   /translation="MNASVFLRRMLPMLAAFLMASCGDPTVSYWKEVADINTEYSEKSD
FT                   ALVQHLLKLKKNPTLPGLEESSRDAADLLRERDEELADLSTKNVDPAVTAYVEEDRKLF
FT                   ARGRELAERYQQYFEKYLKGGPDFTPDPSRAVAHIGRGRQEIRKILAEARKLEARAEML
FT                   RKEKSAELEQELPPLHFRLPELKQLLSSR"
FT                   /protein_id="YP_001876707.1"
FT   sig_peptide     107958..108029
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.675) with cleavage site probability 0.628 at
FT                   residue 24"
FT                   /locus_tag="Amuc_0081"
FT   gene            complement(108852..109427)
FT                   /db_xref="GeneID:6275032"
FT                   /locus_tag="Amuc_0082"
FT   CDS_pept        complement(108852..109427)
FT                   /locus_tag="Amuc_0082"
FT                   /gene_family="HOG000062010" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:187734596"
FT                   /db_xref="GeneID:6275032"
FT                   /translation="MKREFSPSPKSSRCNEKIFQILGLLVSLFFHAPAWGDMADNGIEC
FT                   SVVMEKASFDPRAAFPDFKLVFANKGEKAVRLFDDFYPFKERGPNMIIKIWSKGNGKKG
FT                   KRPTAWYLPSYQMERVANLMHFITLNPGEKHEVPVKDAYLLLTCLQPLASGKIYELEVR
FT                   FRDEYGDPGARREYVGKKDFIVIDQTPR"
FT                   /protein_id="YP_001876708.1"
FT   sig_peptide     complement(109317..109427)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.945 at
FT                   residue 37"
FT                   /locus_tag="Amuc_0082"
FT   gene            complement(109564..110103)
FT                   /db_xref="GeneID:6275030"
FT                   /locus_tag="Amuc_0083"
FT   CDS_pept        complement(109564..110103)
FT                   /locus_tag="Amuc_0083"
FT                   /gene_family="HOG000062010" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:187734597"
FT                   /db_xref="GeneID:6275030"
FT                   /translation="MKKIFRYLVLLASLSLHAVAWGDMADNGVECSVVMEKTEFDARAA
FT                   FPDFKLVFTNKGEKTVRLFDDFYPLKDNGPNIFIKIFQKQTRGQKKEAAWYNPRYQIER
FT                   GRFLNFIALKPGEKHEVLIKDAYLLMLYLKPFRRLINGENYELEVSFHDGYGDPGVRRK
FT                   YVGRKDFSVVDQSPWR"
FT                   /protein_id="YP_001876709.1"
FT   sig_peptide     complement(110035..110103)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.641 at
FT                   residue 23"
FT                   /locus_tag="Amuc_0083"
FT   gene            complement(110100..111743)
FT                   /db_xref="GeneID:6275024"
FT                   /locus_tag="Amuc_0084"
FT   CDS_pept        complement(110100..111743)
FT                   /locus_tag="Amuc_0084"
FT                   /gene_family="HOG000062011" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:187734598"
FT                   /db_xref="GeneID:6275024"
FT                   /translation="MNNYIPINKAVNPVYIYQGNEPLISKTLGVDAMTFNFDGSACEHA
FT                   TCTGAPEMFIKVEEDGLYYFGVEADDTGSLTIAGEQAIKKDGIPPNGKLNIETDSRYLK
FT                   AGYYKVALSYTNNAYTPVSNNAIAFNVTMDREPIQAGKYEGNSTMKREFSSSPKIKLWT
FT                   IEKESAITCEPSKEVGLEFEKPDPVYLEGNGDCNVSSLRPKICVTVCKDESENVWRCRV
FT                   VSVSAGAKLTMYEGIYVNPYVDPPLNEEEATEAVNEMNGYQSRAEVGTWHTPQASLAHE
FT                   EHHRRQWEDAYKFYWKDSKIQEMLENQTISCDKEPNMDEAVKFMQALANEMALDLWKET
FT                   SDYVLALPDDANDRPYCAGQEVLNEATAYVIRLADAMGWNNVPRFITKPGTIEPPCFMP
FT                   PVSEGKTRSMAIAEESTPLQISIVDTSQFTEGKITVRFCNEGNEPVRIPDEINDETSDF
FT                   FFVTVLRTQQGKMRVLNREIGTMTFQRPLNYRELAPGQEYSVTIPACLDEVDLEGWKQC
FT                   SCELETRYYNQQGKDCFLGVLRATARFTLQ"
FT                   /protein_id="YP_001876710.1"
FT   misc_feature    complement(111396..>111581)
FT                   /note="PA14 domain; Region: PA14; cl08459"
FT                   /db_xref="CDD:164115"
FT                   /locus_tag="Amuc_0084"
FT   gene            112173..112247
FT                   /note="tRNA-Cys1"
FT                   /db_xref="GeneID:6275022"
FT                   /locus_tag="Amuc_R0007"
FT   tRNA            112173..112247
FT                   /db_xref="GeneID:6275022"
FT                   /locus_tag="Amuc_R0007"
FT                   /product="tRNA-Cys"
FT   gene            112271..112346
FT                   /note="tRNA-Glu2"
FT                   /db_xref="GeneID:6275020"
FT                   /locus_tag="Amuc_R0008"
FT   tRNA            112271..112346
FT                   /db_xref="GeneID:6275020"
FT                   /locus_tag="Amuc_R0008"
FT                   /product="tRNA-Glu"
FT   gene            112400..112657
FT                   /db_xref="GeneID:6275017"
FT                   /locus_tag="Amuc_0085"
FT   CDS_pept        112400..112657
FT                   /locus_tag="Amuc_0085"
FT                   /gene_family="HOG000248060" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: thiamine biosynthesis protein ThiS; PFAM:
FT                   thiamineS protein; KEGG: gvi:gsl0402 thiamine biosynthesis
FT                   ThiS"
FT                   /db_xref="GI:187734599"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="GeneID:6275017"
FT                   /translation="MILDFFSCCGTVASVMAAQNDIMLNGAPYELAEPCSVSRLLELLN
FT                   MKGKPVVVEHNGAALLPQDFSRVTVSPGDRVEIVSIVAGG"
FT                   /protein_id="YP_001876711.1"
FT   sig_peptide     112400..112453
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.941) with cleavage site probability 0.881 at
FT                   residue 18"
FT                   /locus_tag="Amuc_0085"
FT   misc_feature    112460..112654
FT                   /note="ThiaminS ubiquitin-like sulfur carrier protein;
FT                   Region: ThiS; cd00565"
FT                   /db_xref="CDD:176353"
FT                   /locus_tag="Amuc_0085"
FT   misc_feature    order(112574..112576,112628..112636)
FT                   /note="thiS-thiF/thiG interaction site; other site"
FT                   /db_xref="CDD:176353"
FT                   /locus_tag="Amuc_0085"
FT   gene            112700..114601
FT                   /db_xref="GeneID:6275009"
FT                   /locus_tag="Amuc_0086"
FT   CDS_pept        112700..114601
FT                   /locus_tag="Amuc_0086"
FT                   /gene_family="HOG000256550" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutL; PFAM:
FT                   ATP-binding region ATPase domain protein; DNA mismatch
FT                   repair protein domain protein; MutL dimerisation; KEGG:
FT                   pca:Pcar_1304 DNA mismatch repair enzyme"
FT                   /db_xref="GI:187734600"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014763"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="GeneID:6275009"
FT                   /translation="MPSIHVMSPTLASQVAAGEVVERPASVVKELVENSLDAGAKFVRV
FT                   EIRRGGVGMIKVTDDGSGMSRADAELCTKRHATSKLSSLEELFEITHLGFRGEALPSIA
FT                   SVSRFKLCTRQQQDLEGWEIRIDGGLEHEPRSSGVSPGTAIEVADLFYNTPARRKFLKS
FT                   AETEASHVEHQIRLHALAYPQVRFAYKRDDQLVFDLPATADLRVRISALTDAATAAALI
FT                   PIETTIGPGISITGFLLPLSEARRTRKGQYVFMNTRPVEDQLINRAIRDGYGGFPTGLH
FT                   PALFLYMEVEPALVDVNVHPAKKEVRFRRSADVVNTIVEAIANTLQKHARQEIHAAAAP
FT                   EPERTLPPAHSTTAPYGEIPARSTNPGSAFPAAARPAPASSAAQPPLSSSAKQSHGAVP
FT                   PPTLRAIPLKQVPATQGKLDFHRQEDEETARNAHENAALERDASAGFSYLGTLRQQFAL
FT                   FETPEGLVLMHPKAARERIIFERLRARREAPMPSQQLLDPVVLDLDPRDFAVIRQFAPH
FT                   FDQAGMAVTPFGQNTIRIESIPALLELENARAFLLELVDRLTQSEFSRNAKRVAYETFI
FT                   GEFARKSAWRERISPHRAPAILKDLLACEVPYCTPGGKPTLVNYSVPEIKRKFGLQA"
FT                   /protein_id="YP_001876712.1"
FT   misc_feature    112703..114589
FT                   /note="DNA mismatch repair protein; Reviewed; Region: mutL;
FT                   PRK00095"
FT                   /db_xref="CDD:166783"
FT                   /locus_tag="Amuc_0086"
FT   misc_feature    112754..>112948
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cl00075"
FT                   /db_xref="CDD:173995"
FT                   /locus_tag="Amuc_0086"
FT   misc_feature    113387..113677
FT                   /note="MutL_Trans: transducer domain, having a ribosomal S5
FT                   domain 2-like fold, conserved in the C-terminal domain of
FT                   DNA mismatch repair (MutL/MLH1/PMS2) family. This
FT                   transducer domain is homologous to the second domain of the
FT                   DNA gyrase B subunit, which is...; Region: MutL_Trans;
FT                   cd00782"
FT                   /db_xref="CDD:48466"
FT                   /locus_tag="Amuc_0086"
FT   misc_feature    113606..113608
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:48466"
FT                   /locus_tag="Amuc_0086"
FT   misc_feature    114044..114379
FT                   /note="MutL C terminal dimerization domain; Region: MutL_C;
FT                   cl07336"
FT                   /db_xref="CDD:157790"
FT                   /locus_tag="Amuc_0086"
FT   gene            complement(114737..114853)
FT                   /db_xref="GeneID:6275003"
FT                   /locus_tag="Amuc_0087"
FT   CDS_pept        complement(114737..114853)
FT                   /locus_tag="Amuc_0087"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:187734601"
FT                   /db_xref="GeneID:6275003"
FT                   /translation="MRPNARVLVDKTEKVSVAGQGKMLPVARESFCPLLRLK"
FT                   /protein_id="YP_001876713.1"
FT   gene            114937..116889
FT                   /db_xref="GeneID:6275001"
FT                   /locus_tag="Amuc_0088"
FT   CDS_pept        114937..116889
FT                   /locus_tag="Amuc_0088"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mms:mma_0637 hypothetical protein"
FT                   /db_xref="GI:187734602"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="GeneID:6275001"
FT                   /translation="MPDSPPSTSPAPRIAETAAGKILAGLLALFYIFLATTAAGGEWHT
FT                   LFLPACFLAAALLLFCFCILRGYKIPSPGLPGWLALGLGGGYFLVRAWFSPWFYYESVA
FT                   DLGLIATAIVMFAAGTYAGAGNGEKSILPVLAAALGLLNALLWGYQNITGTEASWFRPD
FT                   YSLFGTEIRNIGLFGYKNFSAHFLSVTGFFLCAYSMASARKWGIRLFTGLALILVSFTC
FT                   GSRSAFPNALAGVTLCFFIYTSSVFRNNRKFYTASILFIILLFLGTSYAVLDLSRGAGR
FT                   LAALLDTFSFGNRLDLSKLAWALADQAPLFGHGSRMYTNLSTEFFSGANLPNFAHHEYA
FT                   QAACDYGYAGLGLMLALLALFLIFGLRSVLKLSGEHQRPNPLGPAAFCVLCIAAFHAYG
FT                   EFIWHNPALLGASALCGGITCTAPLSRVKASRQAGRWLQATAALLMAILALCYAFLAFP
FT                   VWKNSLQAVPASSGNRLPMLEAAASCSLDPDLVRRNILHAAGSSPPPNPARLKALEHQE
FT                   EKAELLSPGNHGLTAAKSLLYILQGRLTEAEQLLRPYVESPGRFDDRMFAWTTIYNNML
FT                   YSWSTAIAAQSPGRALSMAMTAQRLMSAQTDRWLYYGALDPEVRKKHYSRLNELKMLIM
FT                   MLQARGTTPDPSWRK"
FT                   /protein_id="YP_001876714.1"
FT   misc_feature    115573..115977
FT                   /note="O-Antigen ligase; Region: Wzy_C; cl04850"
FT                   /db_xref="CDD:156339"
FT                   /locus_tag="Amuc_0088"
FT   gene            117286..117642
FT                   /db_xref="GeneID:6274997"
FT                   /locus_tag="Amuc_0089"
FT   CDS_pept        117286..117642
FT                   /locus_tag="Amuc_0089"
FT                   /gene_family="HOG000017981" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF488"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF488; KEGG:
FT                   pcu:pc0505 hypothetical protein"
FT                   /db_xref="GI:187734603"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="GeneID:6274997"
FT                   /translation="MNITIKRIYDPKEPGDGYRVLVDRLWPRGISKEKASWDEWLKNIA
FT                   PSTALRQWFAHDPVRWDAFRKKYDEELDGNGEAVSHLLRLARKGKVTLLYSARNTEHNE
FT                   AAALRDYLLQRFAS"
FT                   /protein_id="YP_001876715.1"
FT   misc_feature    117292..117630
FT                   /note="Protein of unknown function, DUF488; Region: DUF488;
FT                   cl01246"
FT                   /db_xref="CDD:154288"
FT                   /locus_tag="Amuc_0089"
FT   gene            complement(117979..118956)
FT                   /db_xref="GeneID:6274995"
FT                   /locus_tag="Amuc_0090"
FT   CDS_pept        complement(117979..118956)
FT                   /locus_tag="Amuc_0090"
FT                   /gene_family="HOG000228588" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="KEGG: rrs:RoseRS_1750 porphobilinogen deaminase;
FT                   TIGRFAM: porphobilinogen deaminase; PFAM: Porphobilinogen
FT                   deaminase"
FT                   /db_xref="GI:187734604"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="GeneID:6274995"
FT                   /translation="MTSKNTLIIGTRGSALALAQADMVRAALSLRYPELDVRCEIIHTI
FT                   GDRRTDVPLADVARVSGMVDKGIFIKELETALRDGRIDVAVHSLKDVPSELAAGFTLAA
FT                   VLPRAAVEDVLITKEPDWNGSGTLATGSVRRRLMARTYWGSGLRFENLRGNVPTRLGKL
FT                   VEHPGWDAVILARAGLERLGLYAPETLVEGRKLYMRPLPVEVFIPAVGQGIVGMECRSS
FT                   DRETAEMLEGINDPESFACALAERAFLVRLGANCSTPVGVYAHPDGEELVLRAAYYVPG
FT                   REEPFAVVIRGDRKAPEALGLRAFEELGLSGWRKTSSCSGCGEK"
FT                   /transl_table="11"
FT                   /protein_id="YP_001876716.1"
FT   sig_peptide     complement(118897..118956)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.890) with cleavage site probability 0.459 at
FT                   residue 20"
FT                   /locus_tag="Amuc_0090"
FT   misc_feature    complement(118033..118950)
FT                   /note="porphobilinogen deaminase; Reviewed; Region: hemC;
FT                   PRK00072"
FT                   /db_xref="CDD:166764"
FT                   /locus_tag="Amuc_0090"
FT   misc_feature    complement(118033..118938)
FT                   /note="Hydroxymethylbilane synthase (HMBS), also known as
FT                   porphobilinogen deaminase (PBGD), is an intermediate enzyme
FT                   in the biosynthetic pathway of tetrapyrrolic ring systems,
FT                   such as heme, chlorophylls, and vitamin B12. HMBS catalyzes
FT                   the conversion of...; Region: HMBS; cl03189"
FT                   /db_xref="CDD:155337"
FT                   /locus_tag="Amuc_0090"
FT   misc_feature    complement(order(118096..118098,118102..118104,
FT                   118111..118113,118120..118122,118135..118137,
FT                   118171..118173,118177..118179,118189..118191,
FT                   118210..118212,118219..118224,118234..118236,
FT                   118243..118245,118264..118266,118318..118341,
FT                   118414..118419,118426..118428,118492..118494,
FT                   118534..118536,118546..118551,118555..118557,
FT                   118618..118635,118639..118644,118669..118671,
FT                   118675..118692,118900..118902,118915..118917))
FT                   /note="domain interfaces; other site"
FT                   /db_xref="CDD:29604"
FT                   /locus_tag="Amuc_0090"
FT   misc_feature    complement(order(118189..118191,118318..118323,
FT                   118330..118332,118414..118416,118423..118425,
FT                   118432..118440,118480..118482,118501..118503,
FT                   118552..118557,118561..118569,118684..118689,
FT                   118693..118695,118897..118899,118909..118911))
FT                   /note="active site"
FT                   /db_xref="CDD:29604"
FT                   /locus_tag="Amuc_0090"
FT   gene            complement(118946..119968)
FT                   /db_xref="GeneID:6274993"
FT                   /locus_tag="Amuc_0091"
FT   CDS_pept        complement(118946..119968)
FT                   /locus_tag="Amuc_0091"
FT                   /gene_family="HOG000109651" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.70"
FT                   /note="KEGG: hmo:HM1_1964 glutamyl-tRNA reductase; TIGRFAM:
FT                   glutamyl-tRNA reductase; PFAM: Shikimate/quinate
FT                   5-dehydrogenase; Tetrapyrrole biosynthesis, glutamyl-tRNA
FT                   reductase-like"
FT                   /db_xref="GI:187734605"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="GeneID:6274993"
FT                   /translation="MRMVCLGLNHRTAPVEIRERFAVPSHKLREEGQRIRSLPGVDQCV
FT                   VLSTCNRMEIYYWSNAPENAQEHILSHFLGDGRGELDMASYFYSHQGEDALGHLCRVLS
FT                   GLDSMVLGETEIFGQVKTAYQTALDAGVTAACANKTFQKAFTIGKKVRTESQIHAGATS
FT                   VGSVAVELAEQIFGDLSGTRVLILGAGEMSRVTGRALHARGAEGIYVANRSFDRAVELA
FT                   GMIGGQAIRYDVWGNYLRDIDVVVAATAAPHCIITRETLLPLRASRKYRSLFLIDISVP
FT                   RNISPDVADIDEVYLYDIDTLTQLADEAKRSRKQEVSRCEAIIRDSISRYFPDSALYDQ
FT                   "
FT                   /transl_table="11"
FT                   /protein_id="YP_001876717.1"
FT   misc_feature    complement(119018..119962)
FT                   /note="NADP-binding domain of glutamyl-tRNA reductase;
FT                   Region: NAD_bind_Glutamyl_tRNA_reduct; cd05213"
FT                   /db_xref="CDD:133452"
FT                   /locus_tag="Amuc_0091"
FT   misc_feature    complement(order(119582..119584,119594..119596,
FT                   119603..119605,119615..119617,119624..119626,
FT                   119822..119824,119912..119914))
FT                   /note="tRNA; other site"
FT                   /db_xref="CDD:133452"
FT                   /locus_tag="Amuc_0091"
FT   misc_feature    complement(order(119612..119614,119624..119626,
FT                   119630..119632,119645..119647,119813..119815,
FT                   119819..119824))
FT                   /note="putative tRNA binding site; other site"
FT                   /db_xref="CDD:133452"
FT                   /locus_tag="Amuc_0091"
FT   misc_feature    complement(order(119390..119392,119399..119401,
FT                   119405..119407))
FT                   /note="putative NADP binding site; other site"
FT                   /db_xref="CDD:133452"
FT                   /locus_tag="Amuc_0091"
FT   gene            complement(119968..120726)
FT                   /db_xref="GeneID:6274989"
FT                   /locus_tag="Amuc_0092"
FT   CDS_pept        complement(119968..120726)
FT                   /locus_tag="Amuc_0092"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cytochrome c assembly protein"
FT                   /transl_table="11"
FT                   /note="PFAM: cytochrome c assembly protein; KEGG:
FT                   pca:Pcar_3065 cytochrome c biogenesis protein"
FT                   /db_xref="GI:187734606"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="GeneID:6274989"
FT                   /translation="MNDNWWAIASLILSLAFTGLGWRLLASGRRFLYAHLWMACLFVLQ
FT                   TGALCVKAYQTGMCPIRGASEVLFFLSWSINLFYLMLGRAYRMSVLGIFTAPAIAVLTV
FT                   FSLLIGRSGADVQGTHDFWVTAHVGIAMMSYGAGGLAAAAGAAFCMQNECLKRHRIPGT
FT                   CRVLPPIRTLEASMKRLVLVAFLLLLLGEWLGWRGNLPINAAKTSIVILLTAGYSVLLW
FT                   FIYRRGIPGRMLACCCVALFIASMSIFLVS"
FT                   /protein_id="YP_001876718.1"
FT   misc_feature    complement(<120322..120615)
FT                   /note="Cytochrome C assembly protein; Region:
FT                   Cytochrom_C_asm; cl00504"
FT                   /db_xref="CDD:174248"
FT                   /locus_tag="Amuc_0092"
FT   gene            complement(120747..121541)
FT                   /db_xref="GeneID:6274987"
FT                   /locus_tag="Amuc_0093"
FT   CDS_pept        complement(120747..121541)
FT                   /locus_tag="Amuc_0093"
FT                   /gene_family="HOG000280679" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF198"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF198; KEGG:
FT                   mgm:Mmc1_1766 protein of unknown function DUF198"
FT                   /db_xref="GI:187734607"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="GeneID:6274987"
FT                   /translation="MQELKDTQSEADTRNISIDRVGVKGLRFPIQIQDKLNRIQSTVAT
FT                   VSLAVDLPEEFKGTHMSRFVEALHQHGPLLDVHTALAIPRELLRRLSARRSHVEMEFPF
FT                   FRSKNAPVTGIEGLMDYVVRFEMEAEANNKLADFKLTVIVPVTTLCPCSKAMSAYGAHN
FT                   QRGLVTYSVRFASRPVWIEDLIDLVESCASCSLFSVLKRPDEKWVTEKAYENPVFVEDL
FT                   VRNVALKTQSHSAFSWYRVEAENFESIHNHQAYAVIERDLRS"
FT                   /protein_id="YP_001876719.1"
FT   misc_feature    complement(120753..121541)
FT                   /note="Uncharacterized ACR, COG1469; Region: DUF198;
FT                   cl00642"
FT                   /db_xref="CDD:174325"
FT                   /locus_tag="Amuc_0093"
FT   gene            complement(121649..121894)
FT                   /db_xref="GeneID:6274985"
FT                   /locus_tag="Amuc_0094"
FT   CDS_pept        complement(121649..121894)
FT                   /locus_tag="Amuc_0094"
FT                   /gene_family="HOG000218466" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal protein S18"
FT                   /transl_table="11"
FT                   /note="PFAM: ribosomal protein S18; KEGG: lme:LEUM_1968
FT                   ribosomal protein S18"
FT                   /db_xref="GI:187734608"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="GeneID:6274985"
FT                   /translation="MSTEPKTVERRIRFRTCNRQMPRRRLDIPMDQVNLLNPDFLSKFT
FT                   SETGKILPRRVTGLSAKMHRKVTREIKRARSINLLP"
FT                   /protein_id="YP_001876720.1"
FT   misc_feature    complement(121655..121786)
FT                   /note="Ribosomal protein S18; Region: Ribosomal_S18;
FT                   cl00373"
FT                   /db_xref="CDD:174155"
FT                   /locus_tag="Amuc_0094"
FT   gene            complement(121926..122099)
FT                   /db_xref="GeneID:6274979"
FT                   /locus_tag="Amuc_0095"