(data stored in ACNUC7421 zone)

EMBL: AL009126.ADAA

AL009126.ADAA        Location/Qualifiers
FT   CDS_pept        203729..204364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adaA"
FT                   /locus_tag="BSU_01810"
FT                   /old_locus_tag="BSU01810"
FT                   /product="methylphosphotriester-DNA alkyltransferase and
FT                   transcriptional regulator (AraC/XylS family)"
FT                   /function="16.6: Maintain"
FT                   /function="16.3: Control"
FT                   /EC_number="2.1.1.63"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 1744039, 2120677, 7565865,
FT                   8376346; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01810"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11957"
FT                   /db_xref="GOA:P19219"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR016220"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="SubtiList:BG10166"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19219"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:1744039, 2120677, 7565865, 8376346"
FT                   /protein_id="CAB11957.1"
FT                   /translation="MPDSINNGHKESHDHRISNDAEMITDEKWQAIINNDAAYNNQFFY
FT                   AVKSTGIFCKPSCKSRVPKKENVCIFPNTEQALRANFRPCKRCKPTNEKMPDSEWVDLI
FT                   TEYIDKNFTEKLTLESLADICHGSPYHMHRTFKKIKGITLVEYIQQVRVHAAKKYLIQT
FT                   NKAIGDIAICVGIANAPYFITLFKKKTGQTPARFRQMSKMEETYNGNK"
     atgccggata gtatcaataa cggacataaa gagagccatg atcatagaat ttcgaatgat        60
     gcagaaatga taacagatga aaagtggcaa gcaattataa ataatgatgc agcgtacaat       120
     aatcaatttt tctacgctgt taaatcgaca gggatattct gtaaaccatc ctgtaaatct       180
     cgcgttccga aaaaagaaaa tgtatgtatc tttccaaaca cagaacaagc tctccgcgca       240
     aattttcgcc cttgtaaacg ttgcaagccc actaatgaaa aaatgcctga tagcgagtgg       300
     gttgatttaa ttactgaata cattgataaa aatttcacag aaaaattaac gctagaatcg       360
     ttagcagata tttgtcatgg gagtccgtat catatgcatc gaacatttaa aaaaattaaa       420
     ggcattacgc tggttgagta tatacaacaa gttagagtac acgcggctaa aaagtatttg       480
     attcagacaa ataaagcgat tggagatatc gctatatgtg tgggtatagc taacgcgcct       540
     tattttatta ctttatttaa aaagaaaact ggacagacac cagcacgatt tcgtcaaatg       600
     agtaaaatgg aggaaacgta caatggaaac aaataa                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page