(data stored in ACNUC7421 zone)

EMBL: AL009126.ADAB

AL009126.ADAB        Location/Qualifiers
FT   CDS_pept        204351..204890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adaB"
FT                   /locus_tag="BSU_01820"
FT                   /old_locus_tag="BSU01820"
FT                   /product="O6-methylguanine-DNA methyltransferase; prophage
FT                   1 region"
FT                   /function="16.6: Maintain"
FT                   /EC_number="2.1.1.63"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 1744039, 2120677, 7565865,
FT                   8376346; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01820"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11958"
FT                   /db_xref="GOA:P19220"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="SubtiList:BG10167"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19220"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:1744039, 2120677, 7565865, 8376346"
FT                   /protein_id="CAB11958.1"
FT                   /translation="METNKPTLYWSLLMFKDWNFYIASTLKGLVFVGSQNKPIEELFEW
FT                   ARKRFPGSLLVEDDDKLEPYAVEITQYLEGKRKNFTVPVEYAGTQFQLAVWNALCEIPY
FT                   GQTKSYSDIANDINKPAAVRAVGAAIGANPVLITVPCHRVIGKNGSLTGYRGGFEMKTL
FT                   LLDLEKRASSEMDVPH"
     atggaaacaa ataaaccaac cctttattgg tctttactaa tgttcaagga ttggaatttt        60
     tatattgctt caactttaaa ggggcttgtg tttgtaggtt cacagaacaa accaatcgag       120
     gaattgttcg aatgggctag gaaacgcttt ccgggaagtc ttcttgttga agatgatgat       180
     aagcttgaac cctatgccgt tgaaatcact caatatctag aaggaaagcg gaaaaacttt       240
     actgttccag ttgagtacgc cggtacgcaa tttcagctag ccgtctggaa tgcactttgt       300
     gaaattcctt atggacagac gaaatcctat tccgacattg caaatgatat aaataaacca       360
     gcagctgttc gtgctgtagg tgcggctatt ggggctaatc cggtattaat tactgtaccg       420
     tgccatcgtg taataggaaa gaatggctca ttaactggct atcggggcgg atttgaaatg       480
     aagacactgc tcctcgatct ggaaaagcga gcttcatctg aaatggatgt tcctcattga       540
//

If you have problems or comments...

PBIL Back to PBIL home page