(data stored in ACNUC7421 zone)

EMBL: AL009126.ADK

AL009126.ADK         Location/Qualifiers
FT   CDS_pept        145877..146530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="BSU_01370"
FT                   /old_locus_tag="BSU01370"
FT                   /product="adenylate kinase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.7: Manage energy"
FT                   /EC_number="2.7.4.3"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 8061005, 8288548, 9056261,
FT                   9715904, 11106368, 16452168; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01370"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11913"
FT                   /db_xref="GOA:P16304"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="PDB:1P3J"
FT                   /db_xref="PDB:2EU8"
FT                   /db_xref="PDB:2OO7"
FT                   /db_xref="PDB:2ORI"
FT                   /db_xref="PDB:2OSB"
FT                   /db_xref="PDB:2P3S"
FT                   /db_xref="PDB:2QAJ"
FT                   /db_xref="PDB:3DKV"
FT                   /db_xref="PDB:3DL0"
FT                   /db_xref="PDB:4MKF"
FT                   /db_xref="PDB:4MKG"
FT                   /db_xref="PDB:4MKH"
FT                   /db_xref="PDB:4QBF"
FT                   /db_xref="PDB:4QBG"
FT                   /db_xref="PDB:4TYP"
FT                   /db_xref="PDB:4TYQ"
FT                   /db_xref="PDB:5X6I"
FT                   /db_xref="SubtiList:BG10446"
FT                   /db_xref="UniProtKB/Swiss-Prot:P16304"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:8061005, 8288548, 9056261, 9715904, 11106368,
FT                   16452168"
FT                   /protein_id="CAB11913.1"
FT                   /translation="MNLVLMGLPGAGKGTQGERIVEDYGIPHISTGDMFRAAMKEETPL
FT                   GLEAKSYIDKGELVPDEVTIGIVKERLGKDDCERGFLLDGFPRTVAQAEALEEILEEYG
FT                   KPIDYVINIEVDKDVLMERLTGRRICSVCGTTYHLVFNPPKTPGICDKDGGELYQRADD
FT                   NEETVSKRLEVNMKQTQPLLDFYSEKGYLANVNGQQDIQDVYADVKDLLGGLKK"
     atgaacttag tcttaatggg gcttcctggt gccggtaaag gcacacaggg cgaacgaatt        60
     gttgaggatt atgggattcc tcatatctca acaggagata tgttccgtgc tgctatgaaa       120
     gaagaaacac cactcggact cgaagcaaaa tcttatattg ataagggaga gctcgtacct       180
     gacgaagtca caatcggaat tgtaaaagag agacttggca aagatgattg tgaaagaggt       240
     tttcttctgg acggatttcc gcgaacagtc gctcaagccg aagctcttga agaaattctt       300
     gaggaatacg gcaagccgat tgattatgtc attaacattg aagtcgacaa agatgttctg       360
     atggaacgtc tgactggacg cagaatttgc agtgtttgcg gcacaaccta tcatttagtc       420
     tttaatccgc cgaaaacgcc gggtatttgt gataaagacg gaggcgaact ctatcaacgg       480
     gcagatgata atgaggaaac agtctctaaa cggcttgagg taaacatgaa gcaaactcag       540
     cctttactcg atttctattc agagaaaggt tatcttgcaa acgtgaatgg ccagcaggac       600
     attcaagacg tttatgcaga tgtgaaggat cttcttggag gattaaaaaa atga             654
//

If you have problems or comments...

PBIL Back to PBIL home page