(data stored in SCRATCH zone)

EMBL: AL009126.ALKA

AL009126.ALKA        Location/Qualifiers
FT   CDS_pept        complement(202547..203458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alkA"
FT                   /locus_tag="BSU_01800"
FT                   /old_locus_tag="BSU01800"
FT                   /product="DNA-3-methyladenine glycosylase; prophage 1
FT                   region"
FT                   /function="16.6: Maintain"
FT                   /function="16.8: Protect"
FT                   /EC_number="3.2.2.21"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 7565865, 8376346, 16468998;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01800"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11956"
FT                   /db_xref="GOA:P37878"
FT                   /db_xref="InterPro:IPR000035"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR012904"
FT                   /db_xref="SubtiList:BG10165"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37878"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:7565865, 8376346, 16468998"
FT                   /protein_id="CAB11956.1"
FT                   /translation="MTWHEVNDVIVITLPEIFDMNANLGYLTREKNECMYEIENNIITK
FT                   VIAIGEIRSLVQVSVINNKQMIVQFLNDSRPVEQWKREEIVKYIHEWFDLDNDLTPFYE
FT                   MAKADPLLKMPARKFYGLRVIGIPDLFEALCWGVLGQQINLAFAYSLKKQFVEAFGDSI
FT                   EWNGKKYWVFPPYERIARLTPTDLADIKMTVKKSEYIIGIARLMASGELSREKLMKMNF
FT                   KDAEKNLIKIRGIGPWTANYVLMRCLRFPTAFPIDDVGLIHSIKILRNMNRKPTKDEIL
FT                   EISVPWKEWQSYATFYLWRVLY"
     gtgacatggc atgaagtcaa tgatgttatt gtcattacat tacctgaaat tttcgacatg        60
     aatgcgaacc ttggctacct aaccagggaa aaaaatgaat gcatgtatga aatagagaac       120
     aatatcatta caaaagttat agccattggg gaaattcggt ccttagtgca ggtaagcgta       180
     atcaataata aacaaatgat tgttcaattc ctaaacgatt ctagacctgt tgagcagtgg       240
     aaacgggaag agattgtaaa atatattcat gaatggtttg atcttgataa cgatttaact       300
     ccattttatg aaatggcaaa agcagatcca ttacttaaaa tgcctgcccg aaaattttat       360
     gggttgcgag tgatcggcat tcccgattta tttgaagctt tatgttgggg agttttaggg       420
     caacaaatta acttagcctt cgcgtactcc ttaaagaagc aatttgtaga agcatttggc       480
     gattctattg aatggaatgg taaaaagtat tgggtgttcc caccgtacga gcgaattgca       540
     cggttaaccc ctaccgacct ggcagatatt aaaatgacgg tgaaaaaaag tgaatatatc       600
     attggaatag ccagattaat ggcaagtgga gaattatcga gggaaaaatt aatgaaaatg       660
     aactttaaag atgctgaaaa aaacttaatt aaaatacgag gaatcggtcc ttggacagcc       720
     aattatgttc taatgcgctg ccttaggttc ccgacagctt ttccaatcga tgatgtgggt       780
     cttattcatt cgataaaaat attacgtaat atgaaccgaa agcctacgaa agatgaaatc       840
     ttagaaatat cggttccatg gaaagaatgg caatcatacg ctacctttta tttatggcgt       900
     gtcctttact ga                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page