(data stored in ACNUC7421 zone)

EMBL: AL009126.AMHX

AL009126.AMHX        Location/Qualifiers
FT   CDS_pept        complement(324038..325189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amhX"
FT                   /locus_tag="BSU_03010"
FT                   /old_locus_tag="BSU03010"
FT                   /product="putative amidohydrolase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.5.1.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 8768514; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03010"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12095"
FT                   /db_xref="GOA:P54983"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="InterPro:IPR037484"
FT                   /db_xref="SubtiList:BG11789"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54983"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12095.2"
FT                   /translation="MQKLSEEMKQTIMDIFEHLHANPEVSWKEYETTSFLKQKLEDLGC
FT                   RTRTFSDCTGVVGEIGSGSPVVAVRADIDALWQEVNGTFRANHSCGHDSHMTMALGTLM
FT                   LLKKQPELPKGTIRFIFQPAEEKGGGALKMIEEGVLDDIDYLYGVHVRPIQETQNGRCA
FT                   PSILHGSSQHIEGTIIGEEAHGARPHLGKNSIEIAAFLVHKLGLIHIDPQIPHTVKMTK
FT                   LQAGGESSNIIPGKASFSLDLRAQTNEAMEALIAETERACEAAAAAFGAKIELHKEHSL
FT                   PAATQNKEAEAIMAEAITEIIGAERLDDPLVTTGGEDFHFYAVKVPNLKTTMLGLGCGL
FT                   QPGLHHPHMTFDRNAMFTGIHILANAVLKTFQKAESLAAANAS"
     atgcaaaagc tttcagaaga aatgaaacaa accattatgg acatcttcga gcatctgcac        60
     gcgaaccctg aagtcagctg gaaggaatat gagacaactt catttttgaa acaaaagctt       120
     gaggatttag ggtgccggac gcgcacgttt tcagactgca ccggggttgt cggcgaaatc       180
     ggctcaggct cacctgttgt agcggtacgc gctgatattg acgcgctgtg gcaggaggtt       240
     aacggcacat ttcgcgccaa ccattcctgc ggacacgatt cacatatgac aatggcattg       300
     ggcacgttaa tgctgctaaa aaaacaacct gagcttccga agggcacaat ccgttttatc       360
     tttcagccgg cagaagaaaa aggcggcggc gccttgaaaa tgatagaaga aggcgtgctt       420
     gatgatatcg actatttgta tggcgttcac gtccgtccga tccaggaaac acagaacggc       480
     cgctgcgctc cttctattct gcacggatca agccagcaca ttgagggaac gatcatcggg       540
     gaagaggctc atggcgcccg tccgcacctc gggaaaaaca gcattgaaat tgcggcattt       600
     cttgtacaca agctcggact cattcatatt gacccgcaaa tcccgcatac cgtcaaaatg       660
     acaaaactgc aagccggcgg tgaaagctct aacatcattc caggaaaagc atcgttcagc       720
     cttgatttgc gcgcacagac caatgaagcc atggaggcat taatcgccga aacagaaaga       780
     gcctgtgaag cggccgccgc tgcatttggc gcaaagatcg agctgcacaa agaacacagc       840
     cttcctgcgg caacacaaaa taaagaagct gaagcgatca tggcagaagc cattacggaa       900
     atcatcgggg ctgagcggct tgatgacccg cttgtcacca ccggcggcga ggatttccat       960
     ttttacgccg tgaaggtgcc gaatctgaaa acaacgatgc tcggactagg ctgcgggctc      1020
     cagccggggc tccatcatcc gcacatgacc tttgacagaa atgcgatgtt taccggcatt      1080
     catattttgg cgaacgccgt gctcaaaaca tttcagaagg cggaatcact tgctgccgct      1140
     aacgcttctt aa                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page