(data stored in SCRATCH zone)

EMBL: AL009126.AMIE

AL009126.AMIE        Location/Qualifiers
FT   CDS_pept        complement(188408..189733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amiE"
FT                   /locus_tag="BSU_01670"
FT                   /old_locus_tag="BSU01670"
FT                   /product="amidase hydrolyzing N-acetylmuramyl-L-Ala bond of
FT                   MurNAc peptides"
FT                   /function="16.13: Shape"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 16452451, 20400549; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01670"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11943"
FT                   /db_xref="GOA:O05213"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR022849"
FT                   /db_xref="SubtiList:BG11566"
FT                   /db_xref="UniProtKB/Swiss-Prot:O05213"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:16452451, 20400549"
FT                   /protein_id="CAB11943.2"
FT                   /translation="MKTKTLFIFSAILTLSIFAPNETFAQTAGNLIEPKIINAETAQFS
FT                   TKKLRKVDQMIERDIAAGFPGAVLVVVKDGRIIKKAAYGYSKKYEGSELLRRPAKMKTR
FT                   TMFDLASNTKMYATNFALQRLVSQGKLDVYEKVSAYLPGFKDQPGDLIKGKDKIRVIDV
FT                   LQHQSGLPSSFYFYTPEKAGKYYSQERDKTIEYLTKIPLDYQTGTKHVYSDIGYMLLGC
FT                   IVEKLTGKPLDVYTEQELYKPLRLKHTLYNPLQKGFKPKQFAATERMGNTRDGVIQFPN
FT                   IRTNTLQGEVHDEKAFYSMDGVSGHAGLFSNADDMAILLQVMLNKGSYRNISLFDQKTA
FT                   DLFTAPSATDPTFALGWRRNGSKSMEWMFGPHASENAYGHTGWTGTVTIIDPAYNLGIA
FT                   LLTNKKHTPVIDPEENPNVFEGDQFPTGSYGSVITAIYEAME"
     gtgaaaacaa agacactgtt catattcagt gccattttaa ccctatcgat atttgcgcca        60
     aatgaaacct tcgcacaaac agcaggcaac ttgattgagc cgaaaatcat aaatgcagaa       120
     actgcacaat tctcgacgaa gaagctaagg aaggtagatc agatgataga acgggatatt       180
     gcagcaggat ttccaggcgc cgttcttgtg gtggtgaagg atggacgcat cataaaaaaa       240
     gcagcatacg gctacagtaa aaagtacgaa ggatcagaac tgctgcgccg tccggccaaa       300
     atgaaaaccc gcacgatgtt tgacttagcc tcaaatacaa aaatgtacgc aacaaatttt       360
     gcattgcagc gcttagtcag ccaaggaaaa cttgacgtct atgaaaaagt ttctgcatat       420
     ttgccgggtt tcaaggatca gccgggtgac ctcataaaag gaaaagacaa gatacgtgtc       480
     attgatgtcc tccagcacca atcagggctc ccatcaagct tttactttta cacgccggaa       540
     aaagccggca agtactattc ccaagaacgg gacaaaacga ttgaatattt gacgaaaatt       600
     ccgctcgatt atcaaaccgg gacaaaacac gtatacagtg acattggata tatgctactc       660
     ggatgtattg tcgaaaaact caccggcaaa ccgcttgatg tctacacgga gcaagagctc       720
     tacaaaccgc tcaggctgaa gcataccttg tacaatccgc tgcaaaaggg ctttaaaccg       780
     aaacagttcg cagctactga acgcatgggc aatacacgtg acggcgttat tcaattccct       840
     aacatccgca caaacacgct gcaaggagag gtgcatgacg aaaaagcgtt ttactcaatg       900
     gacggcgtgt ctgggcatgc cggattgttc tcaaatgcag atgatatggc catactgctg       960
     caagtcatgt taaacaaagg ttcataccga aacatttctt tatttgatca gaaaacagcc      1020
     gacctgttta cagcaccttc agcaacagat ccgacattcg ctcttggctg gaggcggaac      1080
     ggaagtaaaa gcatggaatg gatgtttggc cctcatgcca gcgaaaatgc ttacgggcat      1140
     accggctgga cggggacagt tacaattatt gatccagcat acaatttagg catcgcattg      1200
     ttaacaaata aaaagcatac accagttatt gatccggaag aaaatccgaa cgtctttgaa      1260
     ggtgaccaat ttccaacagg cagttatgga agtgtcataa ccgcgattta tgaagcgatg      1320
     gagtga                                                                 1326
//

If you have problems or comments...

PBIL Back to PBIL home page