(data stored in SCRATCH zone)

EMBL: AL009126.AMYE

AL009126.AMYE        Location/Qualifiers
FT   CDS_pept        327618..329597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amyE"
FT                   /locus_tag="BSU_03040"
FT                   /old_locus_tag="BSU03040"
FT                   /product="alpha-amylase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.2.1.1"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 3117969, 9353930; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03040"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12098"
FT                   /db_xref="GOA:P00691"
FT                   /db_xref="InterPro:IPR006046"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031319"
FT                   /db_xref="InterPro:IPR031965"
FT                   /db_xref="PDB:1BAG"
FT                   /db_xref="PDB:1UA7"
FT                   /db_xref="SubtiList:BG10473"
FT                   /db_xref="UniProtKB/Swiss-Prot:P00691"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:3117969, 9353930"
FT                   /protein_id="CAB12098.2"
FT                   /translation="MFAKRFKTSLLPLFAGFLLLFHLVLAGPAAASAETANKSNELTAP
FT                   SIKSGTILHAWNWSFNTLKHNMKDIHDAGYTAIQTSPINQVKEGNQGDKSMSNWYWLYQ
FT                   PTSYQIGNRYLGTEQEFKEMCAAAEEYGIKVIVDAVINHTTSDYAAISNEVKSIPNWTH
FT                   GNTQIKNWSDRWDVTQNSLLGLYDWNTQNTQVQSYLKRFLDRALNDGADGFRFDAAKHI
FT                   ELPDDGSYGSQFWPNITNTSAEFQYGEILQDSASRDAAYANYMDVTASNYGHSIRSALK
FT                   NRNLGVSNISHYASDVSADKLVTWVESHDTYANDDEESTWMSDDDIRLGWAVIASRSGS
FT                   TPLFFSRPEGGGNGVRFPGKSQIGDRGSALFEDQAITAVNRFHNVMAGQPEELSNPNGN
FT                   NQIFMNQRGSHGVVLANAGSSSVSINTATKLPDGRYDNKAGAGSFQVNDGKLTGTINAR
FT                   SVAVLYPDDIAKAPHVFLENYKTGVTHSFNDQLTITLRADANTTKAVYQINNGPETAFK
FT                   DGDQFTIGKGDPFGKTYTIMLKGTNSDGVTRTEKYSFVKRDPASAKTIGYQNPNHWSQV
FT                   NAYIYKHDGSRVIELTGSWPGKPMTKNADGIYTLTLPADTDTTNAKVIFNNGSAQVPGQ
FT                   NQPGFDYVLNGLYNDSGLSGSLPH"
     atgtttgcaa aacgattcaa aacctcttta ctgccgttat tcgctggatt tttattgctg        60
     tttcatttgg ttctggcagg accggcggct gcgagtgctg aaacggcgaa caaatcgaat       120
     gagcttacag caccgtcgat caaaagcgga accattcttc atgcatggaa ttggtcgttc       180
     aatacgttaa aacacaatat gaaggatatt catgatgcag gatatacagc cattcagaca       240
     tctccgatta accaagtaaa ggaagggaat caaggagata aaagcatgtc gaactggtac       300
     tggctgtatc agccgacatc gtatcaaatt ggcaaccgtt acttaggtac tgaacaagaa       360
     tttaaagaaa tgtgtgcagc cgctgaagaa tatggcataa aggtcattgt tgacgcggtc       420
     atcaatcata ccaccagtga ttatgccgcg atttccaatg aggttaagag tattccaaac       480
     tggacacatg gaaacacaca aattaaaaac tggtctgatc gatgggatgt cacgcagaat       540
     tcattgctcg ggctgtatga ctggaataca caaaatacac aagtacagtc ctatctgaaa       600
     cggttcttag acagggcatt gaatgacggg gcagacggtt ttcgatttga tgccgccaaa       660
     catatagagc ttccagatga tggcagttac ggcagtcaat tttggccgaa tatcacaaat       720
     acatctgcag agttccaata cggagaaatc ctgcaggata gtgcctccag agatgctgca       780
     tatgcgaatt atatggatgt gacagcgtct aactatgggc attccataag gtccgcttta       840
     aagaatcgta atctgggcgt gtcgaatatc tcccactatg catctgatgt gtctgcggac       900
     aagctagtga catgggtaga gtcgcatgat acgtatgcca atgatgatga agagtcgaca       960
     tggatgagcg atgatgatat ccgtttaggc tgggcggtga tagcttctcg ttcaggcagt      1020
     acgcctcttt tcttttccag acctgaggga ggcggaaatg gtgtgaggtt cccggggaaa      1080
     agccaaatag gcgatcgcgg gagtgcttta tttgaagatc aggctatcac tgcggtcaat      1140
     agatttcaca atgtgatggc tggacagcct gaggaactct cgaacccgaa tggaaacaac      1200
     cagatattta tgaatcagcg cggctcacat ggcgttgtgc tggcaaatgc aggttcatcc      1260
     tctgtctcta tcaatacggc aacaaaattg cctgatggca ggtatgacaa taaagctgga      1320
     gcgggttcat ttcaagtgaa cgatggtaaa ctgacaggca cgatcaatgc caggtctgta      1380
     gctgtgcttt atcctgatga tattgcaaaa gcgcctcatg ttttccttga gaattacaaa      1440
     acaggtgtaa cacattcttt caatgatcaa ctgacgatta ccttgcgtgc agatgcgaat      1500
     acaacaaaag ccgtttatca aatcaataat ggaccagaga cggcgtttaa ggatggagat      1560
     caattcacaa tcggaaaagg agatccattt ggcaaaacat acaccatcat gttaaaagga      1620
     acgaacagtg atggtgtaac gaggaccgag aaatacagtt ttgttaaaag agatccagcg      1680
     tcggccaaaa ccatcggcta tcaaaatccg aatcattgga gccaggtaaa tgcttatatc      1740
     tataaacatg atgggagccg agtaattgaa ttgaccggat cttggcctgg aaaaccaatg      1800
     actaaaaatg cagacggaat ttacacgctg acgctgcctg cggacacgga tacaaccaac      1860
     gcaaaagtga tttttaataa tggcagcgcc caagtgcccg gtcagaatca gcctggcttt      1920
     gattacgtgc taaatggttt atataatgac tcgggcttaa gcggttctct tccccattga      1980
//

If you have problems or comments...

PBIL Back to PBIL home page