(data stored in ACNUC7421 zone)

EMBL: AL009126.ANSZ

AL009126.ANSZ        Location/Qualifiers
FT   CDS_pept        290915..292042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ansZ"
FT                   /locus_tag="BSU_02690"
FT                   /old_locus_tag="BSU02690"
FT                   /product="L-asparaginase 2 (putative lipoprotein)"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.6: Maintain"
FT                   /EC_number="3.5.1.1"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11914346, 17686772; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02690"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12063"
FT                   /db_xref="GOA:O34482"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="SubtiList:BG12755"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34482"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11914346, 17686772"
FT                   /protein_id="CAB12063.1"
FT                   /translation="MKKQRMLVLFTALLFVFTGCSHSPETKESPKEKAQTQKVSSASAS
FT                   EKKDLPNIRILATGGTIAGADQSKTSTTEYKAGVVGVESLIEAVPEMKDIANVSGEQIV
FT                   NVGSTNIDNKILLKLAKRINHLLASDDVDGIVVTHGTDTLEETAYFLNLTVKSDKPVVI
FT                   VGSMRPSTAISADGPSNLYNAVKVAGAPEAKGKGTLVVLNDRIASARYVTKTNTTTTDT
FT                   FKSEEMGFVGTIADDIYFNNEITRKHTKDTDFSVSNLDELPQVDIIYGYQNDGSYLFDA
FT                   AVKAGAKGIVFAGSGNGSLSDAAEKGADSAVKKGVTVVRSTRTGNGVVTPNQDYAEKDL
FT                   LASNSLNPQKARMLLMLALTKTNDPQKIQAYFNEY"
     atgaaaaaac aacgaatgct cgtacttttt accgcactat tgtttgtttt taccggatgt        60
     tcacattctc ctgaaacaaa agaatccccg aaagaaaaag ctcagacaca aaaagtctct       120
     tcggcttctg cctctgaaaa aaaggatctg ccaaacatta gaattttagc gacaggaggc       180
     acgatagctg gtgccgatca atcgaaaacc tcaacaactg aatataaagc aggtgttgtc       240
     ggcgttgaat cactgatcga ggcagttcca gaaatgaagg acattgcaaa cgtcagcggc       300
     gagcagattg ttaacgtcgg cagcacaaat attgataata aaatattgct gaagctggcg       360
     aaacgcatca accacttgct cgcttcagat gatgtagacg gaatcgtcgt gactcatgga       420
     acagatacat tggaggaaac cgcttatttt ttgaatctta ccgtgaaaag tgataaaccg       480
     gttgttattg tcggttcgat gagaccttcc acagccatca gcgctgatgg gccttctaac       540
     ctgtacaatg cagtgaaagt ggcaggtgcc cctgaggcaa aagggaaagg gacgcttgtt       600
     gttcttaacg accggattgc ctcagcccga tatgtcacca aaacaaacac aactacaaca       660
     gatacattta aatcagaaga aatgggcttc gtcggaacaa ttgcagatga tatctatttt       720
     aataatgaga ttacccgtaa gcatacgaag gacacggatt tctcggtttc taatcttgat       780
     gagctgccgc aggttgacat tatctatgga taccaaaatg acggaagcta cctgtttgac       840
     gctgctgtaa aagccggagc aaaggggatt gtatttgccg gttctgggaa cgggtcttta       900
     tctgatgcag ccgaaaaagg ggcggacagc gcagtcaaaa aaggcgttac agtggtgcgc       960
     tctacccgca cgggaaatgg tgtcgtcaca ccaaaccaag actatgcgga aaaggacttg      1020
     ctggcatcga actctttaaa cccccaaaaa gcacggatgt tgctgatgct tgcgcttacc      1080
     aaaacaaatg atcctcaaaa aatccaagct tatttcaatg agtattga                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page