(data stored in ACNUC7421 zone)

EMBL: AL009126.AROK

AL009126.AROK        Location/Qualifiers
FT   CDS_pept        340025..340585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="BSU_03150"
FT                   /old_locus_tag="BSU03150"
FT                   /product="shikimate kinase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.7.1.71"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 170268, 7612934, 27339308;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03150"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12109"
FT                   /db_xref="GOA:P37944"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="SubtiList:BG10457"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37944"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12109.2"
FT                   /translation="MNAKRAIPVRERNIVLIGFMGVGKTTIGQLVAKKLYRDFIDIDQQ
FT                   IEKDFNMSIPEIFEKKGEDFFRKTEKEYILDICHHKRFKIVSLGGGSFKQEEIRNCCLE
FT                   NCLVLHLDLSWENWKQRADLLIESRPVLHNRSMDEMEQLFNERKVIYDKHNSKVATDNL
FT                   SPEEVADYIVETLKIGWDLYQPM"
     atgaacgcta aacgagccat cccagtaaga gaaagaaata tcgtcctgat cggattcatg        60
     ggtgtaggaa aaacaacaat cggccaattg gtcgctaaaa aattatatag agattttatt       120
     gatattgacc agcagatcga aaaggatttc aatatgtcaa ttcctgagat atttgagaaa       180
     aagggagaag actttttccg gaaaacggag aaggaatata ttttagacat ctgccatcat       240
     aaacgattca aaatcgtatc tctgggcggg ggatctttta aacaagaaga aatcagaaat       300
     tgctgtctgg aaaactgtct cgtgcttcat ctggacctgt catgggagaa ctggaagcag       360
     cgcgcggatt tattgatcga aagccgccct gtactgcata accgttcaat ggatgaaatg       420
     gaacagctgt ttaacgaaag aaaagtcatt tatgacaagc acaattcaaa agtggcaaca       480
     gacaaccttt ccccggaaga ggttgccgat tacattgttg agacattaaa aattggctgg       540
     gatctttatc agccgatgta a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page