(data stored in ACNUC7421 zone)

EMBL: AL009126.BGLC

AL009126.BGLC        Location/Qualifiers
FT   CDS_pept        370259..371692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglC"
FT                   /locus_tag="BSU_03410"
FT                   /old_locus_tag="BSU03410"
FT                   /product="aryl-phospho-beta-d-glucosidase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.2.1.86"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 14652714, 15139916, 18069788;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03410"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12135"
FT                   /db_xref="GOA:P42403"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="SubtiList:BG11181"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42403"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:14652714, 15139916, 18069788"
FT                   /protein_id="CAB12135.1"
FT                   /translation="MIHQHPESFPKHFLWGSASAAYQIEGAWNEDGKGPSVWDVFTKIP
FT                   GKTFKGTNGEIAVDHYHRFKEDVALMAEMGLKAYRFSVSWPRVFPKGKGEINEAGLAFY
FT                   DSLIDELLSHHIEPVLTLYHWDLPQALMDEYGGFESRNIIEDFNHYCITLYKRFGDRVK
FT                   YWVTLNEQNYNFNHGFITAMHPPGVKDRKRFYEANHIAFLANAKAIESFREYVPEGKIG
FT                   PSFAYSPAYPLSSHPEDILAFENAEEFTNNWWLDMYCWGTYPQIPFRCLEKQGWAPTIE
FT                   AGDMDLLAKGKPDFVGVNYYQTITYERNPLDGVSEGKMNTTGQKGTNQETGIPGVFKTK
FT                   KNPHLTTSNWDWTIDPIGLRIGLRRITSRYQLPVFITENGLGEFDKVEDGTVQDDYRID
FT                   YLRSHLEQCRQAISDGVDLIGYCSWSFTDLLSWLNGYQKRYGFVYVNRDEESTSDLKRL
FT                   KKKSFYWYQDVIKTNGESL"
     atgatccacc agcatccaga atcttttccg aaacattttt tgtggggctc tgcttctgca        60
     gcgtaccaga ttgaaggcgc ttggaatgaa gatggcaaag gcccttctgt ttgggatgtg       120
     tttacgaaaa taccgggcaa aacgtttaaa ggaaccaatg gcgagattgc ggttgaccat       180
     tatcaccgat ttaaagaaga tgtcgctctg atggctgaga tggggttaaa agcatatcga       240
     ttttccgtca gctggccacg ggtttttcca aaaggaaaag gagagatcaa tgaagcaggt       300
     ctagcgtttt acgatagtct gattgatgaa ttgctttctc atcacatcga gccggttctg       360
     actttatatc actgggattt gcctcaagcg cttatggacg aatacggcgg gtttgaatcc       420
     agaaacatca tagaggattt taatcactac tgtattactc tttataaacg ttttggagac       480
     agggtgaaat attgggttac gttaaacgaa cagaactaca attttaatca cggatttatt       540
     acagccatgc atccgcctgg agtgaaagac agaaaacgat tttacgaagc aaaccatatt       600
     gcgtttctgg ctaatgcaaa agccatcgaa tcatttagag aatatgtgcc tgaaggcaaa       660
     ataggtccta gctttgctta ttctccggct taccctttat caagtcatcc agaggatata       720
     ctggcatttg aaaacgccga agaatttacg aacaattggt ggcttgacat gtattgctgg       780
     ggaacctacc cgcaaattcc attccgctgc ttggaaaaac agggatgggc gccgacaatt       840
     gaagcaggag atatggacct gctcgccaaa gggaagcctg attttgtagg tgtcaattat       900
     tatcagacga tcacctatga acgaaatccg cttgatggtg tgtcagaagg gaaaatgaat       960
     acgacaggcc aaaagggaac caatcaggag acggggatac ccggagtgtt caaaacgaaa      1020
     aaaaatccgc atctgacaac gagcaactgg gattggacaa ttgacccaat tgggctgcgt      1080
     atcggtcttc gccgaattac aagccgctat cagcttccag tgtttataac agagaacggt      1140
     ttgggtgaat ttgataaagt tgaggacggc actgtacagg atgattatcg aattgattat      1200
     ttgcgttcgc atcttgagca atgcagacaa gccatcagtg acggtgtcga tttaatcggc      1260
     tattgcagct ggtcgtttac tgatctgtta agctggctga acggctacca aaaaagatac      1320
     ggatttgtat atgtcaatcg tgatgaagaa agcacatccg atttaaaacg cttgaagaaa      1380
     aaaagctttt attggtatca agatgtcatc aagacaaacg gagaaagttt ataa            1434
//

If you have problems or comments...

PBIL Back to PBIL home page