(data stored in ACNUC7421 zone)

EMBL: AL009126.BSDC

AL009126.BSDC        Location/Qualifiers
FT   CDS_pept        413157..414578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsdC"
FT                   /locus_tag="BSU_03640"
FT                   /old_locus_tag="BSU03640"
FT                   /product="promiscuous phenolic acid decarboxylase subunit;
FT                   1,4-dihydroxy-2-naphtoate-heptaprenyl diphosphate
FT                   decarboxylase"
FT                   /function="3.2: Degradation"
FT                   /EC_number="4.1.1.61"
FT                   /EC_number="4.1.1.-"
FT                   /note="Evidence 1b: Function from experimental evidences in
FT                   the studied species; PubMedId: 11029449, 15979273,
FT                   17295427, 18388975, 26658822, 26337367; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03640"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12158"
FT                   /db_xref="GOA:P94405"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR032902"
FT                   /db_xref="SubtiList:BG12024"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94405"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12158.1"
FT                   /translation="MAYQDFREFLAALEKEGQLLTVNEEVKPEPDLGASARAASNLGDK
FT                   SPALLFNNIYGYHNARIAMNVIGSWPNHAMMLGMPKDTPVKEQFFEFAKRYDQFPMPVK
FT                   REETAPFHENEITEDINLFDILPLFRINQGDGGYYLDKACVISRDLEDPDNFGKQNVGI
FT                   YRMQVKGKDRLGIQPVPQHDIAIHLRQAEERGINLPVTIALGCEPVITTAASTPLLYDQ
FT                   SEYEMAGAIQGEPYRIVKSKLSDLDVPWGAEVVLEGEIIAGEREYEGPFGEFTGHYSGG
FT                   RSMPIIKIKRVYHRNNPIFEHLYLGMPWTECDYMIGINTCVPLYQQLKEAYPNEIVAVN
FT                   AMYTHGLIAIVSTKTRYGGFAKAVGMRALTTPHGLGYCKMVIVVDEDVDPFNLPQVMWA
FT                   LSTKMHPKHDAVIIPDLSVLPLDPGSNPSGITHKMILDATTPVAPETRGHYSQPLDSPL
FT                   TTKEWEQKLMDLMNK"
     atggcttatc aagatttcag agaatttctc gctgcccttg aaaaagaagg acagctgctt        60
     acagtgaatg aagaggtaaa gccggaaccg gatttagggg cctccgcacg ggcagccagc       120
     aatcttggcg ataaaagccc tgcgctctta tttaacaaca tttacggcta tcataacgcg       180
     cgaattgcga tgaatgtcat cggctcttgg ccaaaccatg ccatgatgct gggcatgccg       240
     aaagacacac cggtaaaaga acagtttttt gaattcgcaa agcgttatga ccagtttccg       300
     atgccggtca aacgtgagga aacagcgcca tttcatgaaa atgaaatcac agaagatatc       360
     aatttgttcg atatactgcc tcttttcaga attaaccagg gtgatggagg ctactattta       420
     gacaaagcat gtgtcatttc ccgtgatctt gaggaccctg acaacttcgg caaacaaaat       480
     gtcggcattt acagaatgca agtcaaagga aaagaccgcc ttggcattca gcctgtcccg       540
     cagcacgata ttgcaatcca tctgcgccaa gctgaagaac gcggcatcaa ccttccggtc       600
     actattgcgc tcggctgtga gccggtcatt acaacggcgg catcgactcc gcttctctat       660
     gatcaatcag aatacgaaat ggcaggtgcg attcaaggcg aaccatatcg catcgtcaaa       720
     tcaaagctgt ctgatcttga tgttccgtgg ggcgctgaag tggtgcttga aggtgagatt       780
     attgccggag agcgcgaata tgaagggccg ttcggtgaat tcacaggcca ttattccggc       840
     ggacgcagca tgccgattat caaaattaaa cgcgtctatc acagaaacaa tccgatcttt       900
     gaacatttat acttaggcat gccttggaca gaatgcgatt acatgatcgg cattaacaca       960
     tgcgtgccgc tttatcagca gttaaaagaa gcgtatccga acgaaattgt ggcagtgaac      1020
     gccatgtaca cacacggttt aatcgcgatt gtttccacaa aaacccgcta tggcggattt      1080
     gcgaaagcgg tcggcatgcg cgcactcaca acgccgcacg gactcggcta ctgcaaaatg      1140
     gtcatagtcg ttgatgagga tgtcgatcca ttcaaccttc cgcaggtcat gtgggcgctt      1200
     tcgaccaaaa tgcatccgaa acatgatgcg gtcatcattc cggacttatc tgtcctgccg      1260
     cttgatccgg gatccaatcc atcaggaatc actcacaaaa tgattctcga cgccactaca      1320
     ccggttgcgc cggaaacaag aggccattat tcacagccgc ttgattctcc gctaacaacg      1380
     aaagaatggg aacaaaaact aatggactta atgaataaat aa                         1422
//

If you have problems or comments...

PBIL Back to PBIL home page