(data stored in SCRATCH zone)

EMBL: AL009126.CAH

AL009126.CAH         Location/Qualifiers
FT   CDS_pept        342538..343494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cah"
FT                   /locus_tag="BSU_03180"
FT                   /old_locus_tag="BSU03180"
FT                   /product="promiscuous acetyl xylan esterase-cephalosporin C
FT                   deacetylase"
FT                   /function="16.8: Protect"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.1.1.41"
FT                   /EC_number="3.1.1.72"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12842474, 19837798, 21382014;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03180"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12112"
FT                   /db_xref="GOA:P94388"
FT                   /db_xref="InterPro:IPR008391"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR039069"
FT                   /db_xref="PDB:1L7A"
FT                   /db_xref="PDB:1ODS"
FT                   /db_xref="PDB:1ODT"
FT                   /db_xref="SubtiList:BG11919"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94388"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12842474, 19837798, 21382014"
FT                   /protein_id="CAB12112.1"
FT                   /translation="MQLFDLPLDQLQTYKPEKTAPKDFSEFWKLSLEELAKVQAEPDLQ
FT                   PVDYPADGVKVYRLTYKSFGNARITGWYAVPDKEGPHPAIVKYHGYNASYDGEIHEMVN
FT                   WALHGYATFGMLVRGQQSSEDTSISPHGHALGWMTKGILDKDTYYYRGVYLDAVRALEV
FT                   ISSFDEVDETRIGVTGGSQGGGLTIAAAALSDIPKAAVADYPYLSNFERAIDVALEQPY
FT                   LEINSFFRRNGSPETEVQAMKTLSYFDIMNLADRVKVPVLMSIGLIDKVTPPSTVFAAY
FT                   NHLETKKELKVYRYFGHEYIPAFQTEKLAFFKQHLKG"
     atgcaactat tcgatctgcc gctcgaccaa ttgcaaacat ataagcctga aaaaacagca        60
     ccgaaagatt tttctgagtt ttggaaattg tctttggagg aacttgcaaa agtccaagca       120
     gaacctgatt tacagccggt tgactatcct gctgacggag taaaagtgta ccgtctcaca       180
     tataaaagct tcggaaacgc ccgcattacc ggatggtacg cggtgcctga caaggaaggc       240
     ccgcatccgg cgatcgtgaa atatcatggc tacaatgcaa gctatgatgg tgagattcat       300
     gaaatggtaa actgggcact ccatggctac gccacattcg gcatgcttgt ccgcggccag       360
     cagagcagcg aggatacgag tatttcaccg cacggtcacg ctttgggctg gatgacgaaa       420
     ggaattcttg ataaagatac atactattac cgcggtgttt atttggacgc cgtccgcgcg       480
     cttgaggtca tcagcagctt cgacgaggtt gacgaaacaa ggatcggtgt gacaggagga       540
     agccaaggcg gaggtttaac cattgccgca gcagcgctgt cagacattcc aaaagccgcg       600
     gttgccgatt atccttattt aagcaacttc gaacgggcca ttgatgtggc gcttgaacag       660
     ccgtaccttg aaatcaattc cttcttcaga agaaatggca gcccggaaac agaagtgcag       720
     gcgatgaaga cactttcata tttcgatatt atgaatctcg ctgaccgagt gaaggtgcct       780
     gtcctgatgt caatcggcct gattgacaag gtcacgccgc cgtccaccgt gtttgccgcc       840
     tacaatcatt tggaaacaaa gaaagagctg aaggtgtacc gctacttcgg acatgagtat       900
     atccctgctt ttcaaactga aaaacttgct ttctttaagc agcatcttaa aggctga          957
//

If you have problems or comments...

PBIL Back to PBIL home page