(data stored in ACNUC7421 zone)

EMBL: AL009126.CDAA

AL009126.CDAA        Location/Qualifiers
FT   CDS_pept        196213..197034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdaA"
FT                   /locus_tag="BSU_01750"
FT                   /old_locus_tag="BSU01750"
FT                   /product="diadenylate cyclase"
FT                   /function="16.3: Control"
FT                   /function="16.6: Maintain"
FT                   /function="16.13: Shape"
FT                   /EC_number="2.7.7.85"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 19901023, 21566650, 23192352,
FT                   25605729, 25616256, 26240071, 28420751; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01750"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11951"
FT                   /db_xref="GOA:Q45589"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="SubtiList:BG11577"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q45589"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:19901023, 21566650, 23192352, 25605729, 25616256,
FT                   26240071, 28420751"
FT                   /protein_id="CAB11951.2"
FT                   /translation="MAFEDIPFLQYLGNAVDILLVWYVIYKLIMVIRGTKAVQLLKGIV
FT                   VIVLVRMASQYLGLSTLQWLMDQAITWGFLAIIIIFQPELRRALEQLGRGRFFSRSGTP
FT                   VEEAQQKTIEAITKAINYMAKRRIGALLTIERDTGMGDYIETGIPLNAKVSSELLINIF
FT                   IPNTPLHDGAVIMKNNEIAAAACYLPLSESPFISKELGTRHRAAVGISEVTDSLTIIVS
FT                   EETGGVSVAKNGDLHRELTEEALKEMLEAEFKKNTRDTSSNRWYWRGKKNG"
     atggcttttg aggatatccc ttttttgcag tacctcggca atgccgttga tattctcctt        60
     gtttggtatg tgatatataa attgattatg gtgatacgcg gcacgaaagc ggttcagctg       120
     ttaaaaggaa ttgtagtcat cgtgcttgtt cgtatggcca gccaatattt gggcctcagc       180
     acacttcaat ggctgatgga ccaagcgata acatggggat ttttagcaat tattattatt       240
     tttcagcctg agctgagaag agcgcttgaa cagctaggcc gcggccgctt tttttcgagg       300
     agcggcacgc ctgttgaaga agcgcagcag aaaacgattg aggccattac aaaagcaatc       360
     aattatatgg cgaaacgccg tataggcgcc ctgctgacca ttgagcggga tactggaatg       420
     ggcgattata ttgagaccgg cataccacta aatgccaaag tcagctctga gctgctgatc       480
     aatattttta ttccaaacac cccgcttcat gacggtgcgg taattatgaa aaataatgaa       540
     attgccgcgg ccgcctgtta tctgccgctt tctgagagcc cgtttatttc aaaagaactg       600
     ggcacgcggc acagagcagc tgtcggtatc agtgaagtaa cagacagttt gacgattatt       660
     gtgtctgaag agaccggcgg cgtcagtgtg gcaaagaacg gcgaccttca cagagagctt       720
     acagaagaag cgctgaaaga aatgcttgaa gccgagttta agaaaaacac cagagacact       780
     tcttctaacc gctggtattg gaggggcaag aaaaatggat aa                          822
//

If you have problems or comments...

PBIL Back to PBIL home page