(data stored in ACNUC7421 zone)

EMBL: AL009126.CESB

AL009126.CESB        Location/Qualifiers
FT   CDS_pept        246658..247548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cesB"
FT                   /locus_tag="BSU_02260"
FT                   /old_locus_tag="BSU02260"
FT                   /product="enantioselective carboxylesterase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.1.1.1"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11389736, 24418394; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02260"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12020"
FT                   /db_xref="GOA:O31452"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="PDB:4CCY"
FT                   /db_xref="SubtiList:BG12740"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31452"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11389736, 24418394"
FT                   /protein_id="CAB12020.1"
FT                   /translation="MIQDSMQFAAVESGLRFYQAYDQSLSLWPIESEAFYVSTRFGKTH
FT                   IIASGPKDAPSLILLHGGLFSSAMWYPNIAAWSSQFRTYAVDIIGDKNKSIPSAAMETR
FT                   ADFAEWMKDVFDSLGLETAHLAGLSLGGSHIVNFLLRAPERVERAVVISPAEAFISFHP
FT                   DVYKYAAELTGARGAESYIKWITGDSYDLHPLLQRQIVAGVEWQDEQRSLKPTENGFPY
FT                   VFTDQELKSIQVPVLLMFGEHEAMYHQQMAFERASVLVPGIQAEIVKNAGHLLSLEQPE
FT                   YVNQRVLSFLCGGIK"
     atgatacaag attcaatgca gtttgccgcg gttgaaagtg gtctgcgctt ttaccaggca        60
     tatgatcaaa gcctttcttt gtggccgatt gagtcggaag cattctatgt ttctactcgt       120
     tttggaaaaa cacatatcat tgcaagtggg ccaaaggacg caccttcgct cattttgctt       180
     cacggaggcc ttttcagctc tgcgatgtgg tatccgaata tcgcagcgtg gagcagtcaa       240
     tttcgtacat atgcggtcga tataatagga gacaaaaata aaagtatacc atcagcagcc       300
     atggaaacga gagctgattt tgcagaatgg atgaaagatg tctttgattc tcttggactt       360
     gagacggcac atctggccgg cctttcgctt ggcgggtccc atatcgtgaa tttcttactc       420
     cgcgcgcctg aaagagtaga gcgggcggtt gttatcagtc ccgctgaagc gtttatttca       480
     tttcatccgg atgtctataa atacgctgca gagcttacag gggcaagagg agctgaatca       540
     tatatcaagt ggatcacagg cgacagttat gatctgcatc ctttactgca aagacaaatt       600
     gtggcgggcg tggaatggca ggatgagcaa aggagcctga agccgacaga aaacggcttt       660
     ccgtacgtgt tcacagacca ggaattgaaa tcaatacaag tcccggtact tctgatgttc       720
     ggtgagcacg aggctatgta ccatcagcaa atggcctttg agcgggcttc ggtattggtg       780
     ccgggaattc aggctgaaat cgtaaagaac gccggacatc tgttatctct ggagcagcca       840
     gagtacgtca atcaacgcgt cttgtccttt ttatgcgggg ggataaaata g                891
//

If you have problems or comments...

PBIL Back to PBIL home page