(data stored in SCRATCH zone)

EMBL: AL009126.COAX

AL009126.COAX        Location/Qualifiers
FT   CDS_pept        79092..79868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaX"
FT                   /locus_tag="BSU_00700"
FT                   /old_locus_tag="BSU00700"
FT                   /product="pantothenate kinase type III"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.7.1.33"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15795230, 16905099, 24784177;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00700"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11846"
FT                   /db_xref="GOA:P37564"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="SubtiList:BG10133"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37564"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15795230, 16905099, 24784177"
FT                   /protein_id="CAB11846.2"
FT                   /translation="MLLVIDVGNTNTVLGVYHDGKLEYHWRIETSRHKTEDEFGMILRS
FT                   LFDHSGLMFEQIDGIIISSVVPPIMFALERMCTKYFHIEPQIVGPGMKTGLNIKYDNPK
FT                   EVGADRIVNAVAAIHLYGNPLIVVDFGTATTYCYIDENKQYMGGAIAPGITISTEALYS
FT                   RAAKLPRIEITRPDNIIGKNTVSAMQSGILFGYVGQVEGIVKRMKWQAKQEPKVIATGG
FT                   LAPLIANESDCIDIVDPFLTLKGLELIYERNRVGSV"
     ttgttactgg ttatcgatgt ggggaacacc aatactgtac ttggtgtata tcatgatgga        60
     aaattagaat atcactggcg tatagaaaca agcaggcata aaacagaaga tgagtttggg       120
     atgattttgc gctccttatt tgatcactcc gggcttatgt ttgaacagat agatggcatt       180
     attatttcgt cagtagtgcc gccaatcatg tttgcgttag aaagaatgtg cacaaaatac       240
     tttcatatcg agcctcaaat tgttggtcca ggtatgaaaa ccggtttaaa tataaaatat       300
     gacaatccga aagaagtagg ggcagacaga atcgtaaatg ctgtcgctgc gatacacttg       360
     tacggcaatc cattaattgt tgtcgatttc ggaaccgcca caacgtactg ctatattgat       420
     gaaaacaaac aatacatggg cggggcgatt gcccctggga ttacaatttc gacagaggcg       480
     ctttactcgc gtgcagcaaa gcttcctcgt atcgaaatca cccggcccga caatattatc       540
     ggaaaaaaca ctgttagcgc gatgcaatct ggaattttat ttggctatgt cggccaagtg       600
     gaaggaatcg ttaagcgaat gaaatggcag gcaaaacagg aaccaaaggt cattgcgaca       660
     ggaggcctgg cgccgctcat tgcgaacgaa tcagattgta tagacatcgt tgatccattc       720
     ttaaccctaa aagggctgga attgatttat gaaagaaacc gcgtaggaag tgtatag          777
//

If you have problems or comments...

PBIL Back to PBIL home page