(data stored in SCRATCH zone)

EMBL: AL009126.CTC

AL009126.CTC         Location/Qualifiers
FT   CDS_pept        58783..59397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctc"
FT                   /locus_tag="BSU_00520"
FT                   /old_locus_tag="BSU00520"
FT                   /product="ribosomal protein BL25 (Ctc), binding 5S RNA"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.6: Maintain"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 8522540, 9669336, 10369900,
FT                   12432960, 17198710; Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00520"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11828"
FT                   /db_xref="GOA:P14194"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="SubtiList:BG10115"
FT                   /db_xref="UniProtKB/Swiss-Prot:P14194"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:8522540, 9669336, 10369900, 12432960, 17198710"
FT                   /protein_id="CAB11828.1"
FT                   /translation="MATLTAKERTDFTRSSLRNIRTSGHVPGIIYGKDTGNKPVSLDSV
FT                   ELIKTLRDEGKNAVITLEVSGEKHSVMVTDLQTDPLKNEITHADFQVVNMSEDIEVEVP
FT                   IHLTGEAIGVKNGGVLQQPLYALTVKAKPKAIPQTIEADISSLDVNEVLTIADLPAGGD
FT                   YSFNHESDEVVASILPPQQQEAAEVDEEESADAQPEGENEQ"
     atggcaactt taacggcaaa agaaagaacg gactttactc gttcgtctct tcggaatatc        60
     cgtacttcag gacatgttcc aggtatcata tatgggaagg atacgggtaa caaacctgtg       120
     tcattagaca gtgtggagct catcaaaacg ctgagggacg aaggcaaaaa tgcagtcatt       180
     acgcttgagg tcagcggaga aaaacactca gtcatggtaa cagacctgca gacggacccg       240
     ctgaaaaatg aaatcactca tgctgatttt caagtagtta atatgagtga ggacattgaa       300
     gtggaagttc cgattcatct gaccggagaa gccattggag tgaaaaacgg aggcgtactg       360
     cagcagccgt tatatgcact tactgtaaag gccaagccaa aagccattcc gcaaacgatt       420
     gaggctgata tttcaagcct cgatgtaaat gaagtactga cgattgcgga tttgcctgct       480
     ggcggtgact actcctttaa tcatgaatca gatgaggttg tggcttcaat ccttcctccg       540
     cagcagcagg aagcagctga ggtcgatgaa gaggaatctg ccgatgctca gcctgaaggt       600
     gaaaacgaac aataa                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page