(data stored in ACNUC7421 zone)

EMBL: AL009126.CUTI

AL009126.CUTI        Location/Qualifiers
FT   CDS_pept        complement(446174..446788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutI"
FT                   /locus_tag="BSU_03940"
FT                   /old_locus_tag="BSU03940"
FT                   /product="putative membrane protein involved in copper
FT                   intake"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 19168619, 22904286,
FT                   27010565, 26822828; Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03940"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12202"
FT                   /db_xref="GOA:P94431"
FT                   /db_xref="InterPro:IPR012533"
FT                   /db_xref="InterPro:IPR038507"
FT                   /db_xref="SubtiList:BG12045"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94431"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12202.1"
FT                   /translation="MLKKIALTLCPAIVGSLLFFTAPASAHVSVKPAESAAGSWETYTM
FT                   KVPSEKNLPTTKVVLKMPKDVEFQQYEPIPGWKVSTQKHDDKSVSVTWEATDGGIQEGQ
FT                   FQQFTFVAKNPDKAEEAAWDAYQYYKDGSIVEWTGDEDADTPHSITNITSAKQVTDEHG
FT                   ATKTEDDSENSGSSALDITAMVLSAAAIILSVAALVKKKRA"
     ttgttgaaaa aaatcgcatt gacactatgt ccggctattg tcggctccct cttattcttt        60
     acggcccctg ccagcgcgca tgtttctgta aaaccggctg agtctgctgc aggctcttgg       120
     gaaacgtata caatgaaggt tccttctgag aaaaatctgc cgacaacgaa ggttgtcctc       180
     aaaatgccga aggatgttga attccagcaa tatgagccaa ttccgggctg gaaggtttcc       240
     actcaaaaac atgatgacaa atcagtatcc gtgacatggg aggcgactga cggaggcatt       300
     caggaaggcc agttccagca gtttaccttt gttgccaaaa accctgacaa agcggaggaa       360
     gctgcttggg acgcatacca atattacaaa gacggcagca ttgttgagtg gacaggtgac       420
     gaggatgccg atacacctca ttccattaca aacatcacgt ctgcaaagca agtgacagat       480
     gagcacggcg ccacgaaaac agaagacgat tccgaaaact caggttcttc agctctagac       540
     attacagcga tggtgctgtc tgcggctgcc attattttat ctgtagcagc acttgtaaag       600
     aaaaagcgtg cctaa                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page