(data stored in ACNUC7421 zone)

EMBL: AL009126.CUTJ

AL009126.CUTJ        Location/Qualifiers
FT   CDS_pept        complement(446801..448426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutJ"
FT                   /locus_tag="BSU_03950"
FT                   /old_locus_tag="BSU03950"
FT                   /product="copper import permease subunit"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15101989, 15849754, 16850406,
FT                   19168619, 22904286, 23012364; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03950"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12203"
FT                   /db_xref="GOA:C0SP95"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032693"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="SubtiList:BG12046"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0SP95"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15101989, 15849754, 16850406, 19168619, 22904286,
FT                   23012364"
FT                   /protein_id="CAB12203.2"
FT                   /translation="MKRNRWWIILLLFLVFLPKTSFAHAYIVKSSPGENSELKSAPAQV
FT                   EIEFNEPVEEGFHYIKVYNSNGDRVDTDKTEIKKDNHHIMTVKLKKNLPKDVYRAEWNA
FT                   VSADGHPVSGVIPFSIGKADGGFSSQKAADSALNPGTAADRAILYTALSLFIGTVFFHL
FT                   FWYKGKSEQLVKRTRRILTGSIAALGLALLLQLPIQTKANAGGGWGSAFQPGYIRETLF
FT                   ETAGGSIWIIQAALFVLLALSVIPAIRKNRFSSFGYWTAPLIFFFGLLLAKAFTGHAAV
FT                   VEEKTVGILMDFLHLTSASIWVGGIAALVLLLSKEWRQPDKTLAWETVRRFSPWALTAV
FT                   GVILFSGLLNGFFIIRSMDSLFHTAYGQALLVKSGLFVFMLVLGAIHFLLTRKQRRTGI
FT                   SRTLKAEWAIGIAVLITAAVFTSLPSPPEPAPEPFYQTKAIENGQSVSLSISPNQPGKN
FT                   VFELRVTDHNGDPVKNIQQITLTVYKTGLSGSENKSTFTLKEKTKGVFQDQNLSINEKG
FT                   NWKIKVHGLTGDFNEINIMFTKTN"
     atgaagcgaa acagatggtg gatcatcctt ctgctttttc ttgttttcct gccgaaaaca        60
     agctttgctc acgcctatat tgtcaaatct tcacctgggg aaaacagcga attaaaaagc       120
     gcccctgcgc aggtggaaat cgaatttaat gaaccggttg aagaagggtt tcattacatt       180
     aaagtctata attcaaacgg cgaccgtgtg gatacggaca agactgaaat caaaaaagat       240
     aatcatcaca tcatgacagt gaagctgaag aagaatctgc ctaaagatgt gtacagagcg       300
     gaatggaatg ccgtatccgc ggatggacat cctgtttccg gcgtcattcc gttcagtatc       360
     gggaaagcgg atggcggatt cagcagccaa aaagcagccg attcagcgct gaatccggga       420
     acagcagcag atcgcgcgat tctgtataca gccttatctc tgtttatcgg aacggttttc       480
     ttccatcttt tctggtataa agggaaatca gaacagctcg tcaaacggac gagacgtatc       540
     ctgaccggct cgatcgcagc attggggctg gcgcttttgc ttcagcttcc gattcagaca       600
     aaagcgaacg caggcggcgg ctggggcagc gcattccagc cgggctacat cagagaaaca       660
     ctgtttgaga cagcaggcgg ctccatttgg atcatacagg ctgcgctgtt cgtgctgctc       720
     gcactgtctg tcatccctgc gatacggaaa aaccgctttt catcctttgg ctattggaca       780
     gcgccgctca ttttcttttt cggtctcctg cttgccaagg cgtttaccgg gcatgctgct       840
     gtcgttgaag aaaaaacggt cggcattttg atggatttcc ttcatttaac ttccgcttcc       900
     atctgggtcg gcggaatagc ggcactcgtt ttgctgctct caaaagaatg gaggcagcct       960
     gacaaaacgc tcgcgtggga gacggtcaga cggttctccc catgggcgct cactgcagtc      1020
     ggcgtcattt tgttttcagg cttgctcaat ggatttttca tcattcgttc aatggattca      1080
     ctgttccata cagcgtacgg acaagctctt ttagtgaaaa gcgggctgtt tgttttcatg      1140
     ctggtcttag gcgcaattca ttttctgctt accagaaagc agcgccgcac aggaatcagc      1200
     cgaacgttga aagcggagtg ggcaatcggc atcgctgtat tgatcacagc ggccgtgttt      1260
     acaagcctgc caagcccgcc tgagccagcg ccggaaccgt tctaccaaac caaagcgata      1320
     gagaacggac aaagcgtttc tctcagcatc agcccaaacc agcctggaaa aaatgttttt      1380
     gagctgcggg tcaccgacca taacggtgat cccgtgaaaa acatccagca aatcacgtta      1440
     accgtttata aaacaggcct gtcaggcagc gaaaacaaaa gcacctttac attaaaagaa      1500
     aaaacaaaag gcgtcttcca agatcaaaac ctgtcgatta atgaaaaagg aaactggaag      1560
     atcaaagtcc acggcctgac cggcgacttt aacgaaatca atatcatgtt tacaaagacc      1620
     aattaa                                                                 1626
//

If you have problems or comments...

PBIL Back to PBIL home page