(data stored in ACNUC7421 zone)

EMBL: AL009126.CWLJ

AL009126.CWLJ        Location/Qualifiers
FT   CDS_pept        282469..282897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cwlJ"
FT                   /locus_tag="BSU_02600"
FT                   /old_locus_tag="BSU02600"
FT                   /product="spore cortex cell wall hydrolase"
FT                   /function="16.3: Control"
FT                   /function="16.5: Explore"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9515903, 11466292, 11807087,
FT                   12177332, 16936016, 26190134, 28333204; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02600"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12054"
FT                   /db_xref="GOA:P42249"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="SubtiList:BG11172"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42249"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9515903, 11466292, 11807087, 12177332, 16936016,
FT                   26190134, 28333204"
FT                   /protein_id="CAB12054.2"
FT                   /translation="MAVVRATSADVDLMARLLRAEAEGEGKQGMLLVGNVGINRLRANC
FT                   SDFKGLRTIRQMIYQPHAFEAVTHGYFYQRARDSERALARRSINGERRWPAKFSLWYFR
FT                   PQGDCPAQWYNQPFVARFKSHCFYQPTAETCENVYNTF"
     atggcggtcg tgagagcaac gagtgcggat gtcgatttga tggcaaggct gctcagagcg        60
     gaagcggaag gcgaaggcaa gcaggggatg ctgcttgtcg gcaacgttgg aattaatcgg       120
     ctgcgggcga attgctcaga ttttaaaggc ctccgcacca tcaggcagat gatttatcag       180
     ccacacgcgt ttgaggctgt gactcatgga tatttttatc aaagggcgcg agatagcgag       240
     cgtgcccttg cacgccggtc gattaatggt gaaaggcgct ggcctgcaaa atttagttta       300
     tggtacttca ggccgcaggg ggactgtcca gcccagtggt ataaccagcc gtttgtggcc       360
     agatttaagt cacactgctt ttatcagccg acggcggaga cgtgtgaaaa tgtatataac       420
     acattttag                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page