(data stored in ACNUC7421 zone)

EMBL: AL009126.CWLK

AL009126.CWLK        Location/Qualifiers
FT   CDS_pept        complement(303804..304307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cwlK"
FT                   /locus_tag="BSU_02810"
FT                   /old_locus_tag="BSU02810"
FT                   /product="murein L,D:-endopeptidase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.4.-.-"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 17588176; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02810"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12075"
FT                   /db_xref="GOA:O34360"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR039561"
FT                   /db_xref="SubtiList:BG12760"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34360"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:17588176"
FT                   /protein_id="CAB12075.1"
FT                   /translation="MNLPAKTFVILCILFLLDLCFSYIRHEWHSQNALQDMPVPSDLHP
FT                   IVKQNADALKAAAANKGIDVVITEGFRSFKEQDELYKQGRTKKGNIVTYARGGESYHNY
FT                   GLAIDFALQKKDGSIIWDMEYDGNQNGKSDWLEVVEIAKTLGFEWGGDWKRFKDYPHLE
FT                   MIPN"
     atgaacttac ccgcaaaaac atttgttatc ttatgtattc tatttcttct agatctttgt        60
     tttagttata ttcggcatga atggcattct caaaacgcct tgcaggacat gcctgtcccc       120
     tcggatcttc atccgattgt gaagcagaat gccgatgcac tcaaagccgc tgcagcgaat       180
     aaaggcattg acgtcgtcat tactgaagga ttcaggtcct ttaaggaaca agatgaatta       240
     tataaacagg gacgtacaaa aaaagggaat attgtcacct atgcaagagg aggggaatcg       300
     tatcataact atggtttagc gattgatttc gcccttcaaa aaaaggatgg cagcatcata       360
     tgggatatgg aatatgacgg caatcaaaac ggaaaatcag attggctgga ggttgtcgag       420
     atcgctaaga cactcggttt cgaatggggc ggggattgga aacgattcaa ggactacccc       480
     cacttggaga tgattcctaa ctag                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page