(data stored in ACNUC7421 zone)

EMBL: AL009126.CYPC

AL009126.CYPC        Location/Qualifiers
FT   CDS_pept        229525..230778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cypC"
FT                   /locus_tag="BSU_02100"
FT                   /old_locus_tag="BSU02100"
FT                   /product="fatty acid beta-hydroxylating cytochrome P450"
FT                   /function="16.8: Protect"
FT                   /function="16.6: Maintain"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="1.11.2.4"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10529095, 12519760, 21673922;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02100"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12004"
FT                   /db_xref="GOA:O31440"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="PDB:1IZO"
FT                   /db_xref="PDB:2ZQJ"
FT                   /db_xref="PDB:2ZQX"
FT                   /db_xref="SubtiList:BG12729"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31440"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10529095, 12519760, 21673922"
FT                   /protein_id="CAB12004.1"
FT                   /translation="MNEQIPHDKSLDNSLTLLKEGYLFIKNRTERYNSDLFQARLLGKN
FT                   FICMTGAEAAKVFYDTDRFQRQNALPKRVQKSLFGVNAIQGMDGSAHIHRKMLFLSLMT
FT                   PPHQKRLAELMTEEWKAAVTRWEKADEVVLFEEAKEILCRVACYWAGVPLKETEVKERA
FT                   DDFIDMVDAFGAVGPRHWKGRRARPRAEEWIEVMIEDARAGLLKTTSGTALHEMAFHTQ
FT                   EDGSQLDSRMAAIELINVLRPIVAISYFLVFSALALHEHPKYKEWLRSGNSREREMFVQ
FT                   EVRRYYPFGPFLGALVKKDFVWNNCEFKKGTSVLLDLYGTNHDPRLWDHPDEFRPERFA
FT                   EREENLFDMIPQGGGHAEKGHRCPGEGITIEVMKASLDFLVHQIEYDVPEQSLHYSLAR
FT                   MPSLPESGFVMSGIRRKS"
     atgaatgagc agattccaca tgacaaaagt ctcgataaca gtctgacact gctgaaggaa        60
     gggtatttat ttattaaaaa cagaacagag cgctacaatt cagatctgtt tcaggcccgt       120
     ttgttgggaa aaaactttat ttgcatgact ggcgctgagg cggcgaaggt gttttatgat       180
     acggatcgat tccagcggca gaacgctttg cctaagcggg tgcagaaatc gctgtttggt       240
     gttaatgcga ttcagggaat ggatggcagc gcgcatatcc atcggaagat gctttttctg       300
     tcattgatga caccgccgca tcaaaaacgt ttggctgagt tgatgacaga ggagtggaaa       360
     gcagcagtca caagatggga gaaggcagat gaggttgtgt tatttgaaga agcaaaagaa       420
     atcctgtgcc gggtagcgtg ctattgggca ggtgttccgt tgaaggaaac ggaagtcaaa       480
     gagagagcgg atgacttcat tgacatggtc gacgcgttcg gtgctgtggg accgcggcat       540
     tggaaaggaa gaagagcaag gccgcgtgcg gaagagtgga ttgaagtcat gattgaagat       600
     gctcgtgccg gcttgctgaa aacgacttcc ggaacagcgc tgcatgaaat ggcttttcac       660
     acacaagaag atggaagcca gctggattcc cgcatggcag ccattgagct gattaatgta       720
     ctgcggccta ttgtcgccat ttcttacttt ctggtgtttt cagctttggc gcttcatgag       780
     catccgaagt ataaggaatg gctgcggtct ggaaacagcc gggaaagaga aatgtttgtg       840
     caggaggtcc gcagatatta tccgttcggc ccgtttttag gggcgcttgt caaaaaagat       900
     tttgtatgga ataactgtga gtttaagaag ggcacatcgg tgctgcttga tttatatgga       960
     acgaaccacg accctcgtct atgggatcat cccgatgaat tccggccgga acgatttgcg      1020
     gagcgggaag aaaatctgtt tgatatgatt cctcaaggcg gggggcacgc cgagaaaggc      1080
     caccgctgtc caggggaagg cattacaatt gaagtcatga aagcgagcct ggatttcctc      1140
     gtccatcaga ttgaatacga tgttccggaa caatcactgc attacagtct cgccagaatg      1200
     ccatcattgc ctgaaagcgg cttcgtaatg agcggaatca gacgaaaaag ttaa            1254
//

If you have problems or comments...

PBIL Back to PBIL home page