(data stored in ACNUC7421 zone)

EMBL: AL009126.CYSK

AL009126.CYSK        Location/Qualifiers
FT   CDS_pept        81771..82697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="BSU_00730"
FT                   /old_locus_tag="BSU00730"
FT                   /product="cysteine synthase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.3: Control"
FT                   /EC_number="2.5.1.47"
FT                   /EC_number="4.4.1.1"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11390694, 15760717, 16267287,
FT                   16513748, 17056751, 18974048; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00730"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11849"
FT                   /db_xref="GOA:P37887"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="SubtiList:BG10136"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37887"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11390694, 15760717, 16267287, 16513748, 17056751,
FT                   18974048"
FT                   /protein_id="CAB11849.1"
FT                   /translation="MVRVANSITELIGNTPIVKLNRLADENSADVYLKLEYMNPGSSVK
FT                   DRIGLAMIEAAEKEGKLKAGNTIIEPTSGNTGIGLAMVAAAKGLKAILVMPDTMSMERR
FT                   NLLRAYGAELVLTPGAEGMKGAIKKAEELAEKHGYFVPQQFNNPSNPEIHRQTTGKEIV
FT                   EQFGDDQLDAFVAGIGTGGTITGAGEVLKEAYPSIKIYAVEPSDSPVLSGGKPGPHKIQ
FT                   GIGAGFVPDILNTEVYDEIFPVKNEEAFEYARRAAREEGILGGISSGAAIYAALQVAKK
FT                   LGKGKKVLAIIPSNGERYLSTPLYQFD"
     atggtacgtg tagcaaactc cattactgaa ttaattggga atacgccaat cgttaaatta        60
     aatcgccttg cagatgaaaa cagtgcggat gtatatctaa aacttgaata catgaaccct       120
     ggaagcagtg taaaagaccg tatcggttta gctatgattg aagcggctga aaaagaagga       180
     aaattaaaag ccggtaatac aatcattgaa ccgacaagcg gaaatactgg aatcgggctt       240
     gcaatggttg ctgctgctaa aggattaaaa gccattttgg ttatgcctga tacaatgagc       300
     atggagcgcc gcaaccttct tcgcgcatat ggtgctgagc ttgtgctgac tcctggtgcg       360
     gaaggcatga aaggtgctat taagaaagct gaagagcttg ctgaaaagca cggatacttt       420
     gtgccgcagc agtttaacaa cccttctaac cccgaaattc accgccaaac aacgggtaaa       480
     gaaatcgttg agcaattcgg tgatgatcag cttgacgcat ttgtagccgg aatcggaacg       540
     ggcggaacga ttacgggagc gggcgaagtg ctgaaggaag catacccttc catcaagatt       600
     tatgctgttg aaccgtcaga ttccccagtg ctttcaggag gaaaaccagg cccccacaaa       660
     attcagggaa tcggagcagg attcgtgccg gacatcttaa acactgaagt atatgatgaa       720
     atcttccctg tgaagaatga agaagcattc gaatatgccc gcagagctgc acgtgaagaa       780
     ggaattctcg gaggcatctc atcaggtgcg gcaatttatg ctgctcttca agtagcaaaa       840
     aaactcggaa aaggcaaaaa agtattggcc atcattccaa gtaacggcga acgttatcta       900
     agcacgccgc tgtaccaatt cgattaa                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page