(data stored in ACNUC7421 zone)

EMBL: AL009126.DACA

AL009126.DACA        Location/Qualifiers
FT   CDS_pept        17534..18865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacA"
FT                   /locus_tag="BSU_00100"
FT                   /old_locus_tag="BSU00100"
FT                   /product="D-alanyl-D-alanine carboxypeptidase
FT                   (penicillin-binding protein 5)"
FT                   /EC_number="3.4.16.4"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 8370539, 9864321, 10383963,
FT                   21378199; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00100"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11786"
FT                   /db_xref="GOA:P08750"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="SubtiList:BG10074"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08750"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:8370539, 9864321, 10383963, 21378199"
FT                   /protein_id="CAB11786.1"
FT                   /translation="MNIKKCKQLLMSLVVLTLAVTCLAPMSKAKAASDPIDINASAAIM
FT                   IEASSGKILYSKNADKRLPIASMTKMMTEYLLLEAIDQGKVKWDQTYTPDDYVYEISQD
FT                   NSLSNVPLRKDGKYTVKELYQATAIYSANAAAIAIAEIVAGSETKFVEKMNAKAKELGL
FT                   TDYKFVNATGLENKDLHGHQPEGTSVNEESEVSAKDMAVLADHLITDYPEILETSSIAK
FT                   TKFREGTDDEMDMPNWNFMLKGLVSEYKKATVDGLKTGSTDSAGSCFTGTAERNGMRVI
FT                   TVVLNAKGNLHTGRFDETKKMFDYAFDNFSMKEIYAEGDQVKGHKTISVDKGKEKEVGI
FT                   VTNKAFSLPVKNGEEKNYKAKVTLNKDNLTAPVKKGTKVGKLTAEYTGDEKDYGFLNSD
FT                   LAGVDLVTKENVEKANWFVLTMRSIGGFFAGIWGSIVDTVTGWF"
     ttgaacatca agaaatgtaa acagctactg atgtcattgg ttgtgttaac tctagctgtc        60
     acgtgtctgg ctccaatgtc aaaagcgaaa gcagccagcg atccaattga tatcaatgca       120
     tctgctgcta ttatgatcga agcttcttca ggtaaaattc tttacagtaa aaatgcagat       180
     aagagactgc caattgcgag tatgacaaaa atgatgacag agtatctgtt attggaagca       240
     attgatcaag gtaaagtgaa atgggaccaa acctatacgc ctgatgacta tgtgtatgaa       300
     atttcccaag ataacagctt atcaaacgtt cctcttcgga aagacgggaa atacacagta       360
     aaagaattat atcaagctac agcaatttat tctgcaaatg ctgctgctat tgcgattgca       420
     gaaatcgttg ccggttctga aactaagttt gttgaaaaaa tgaatgcaaa agcaaaagaa       480
     ctaggcttaa cagattacaa atttgttaac gcaacaggtc ttgaaaacaa agatcttcac       540
     gggcatcagc ctgaggggac aagcgtaaat gaagaaagtg aagtttctgc aaaggatatg       600
     gcggttcttg cggatcactt gattactgac taccctgaga tactggagac ttccagtatc       660
     gccaaaacga aattcagaga aggcaccgat gatgaaatgg acatgccgaa ctggaatttt       720
     atgctgaagg ggcttgtcag cgagtataaa aaagcgactg tagacggact gaaaacaggt       780
     tctactgact ctgcgggttc atgctttaca ggaacagctg aacgcaacgg tatgcgtgtc       840
     atcactgttg ttttaaacgc aaagggcaac cttcatacag gccgtttcga tgaaacgaaa       900
     aaaatgtttg attatgcttt cgacaatttc tccatgaaag aaatttatgc tgaaggcgat       960
     caagtaaaag gccataaaac aatttcagtt gataagggta aagagaaaga agtaggcatt      1020
     gtgacaaaca aggcgttctc tcttcctgtc aaaaatggtg aagaaaagaa ttacaaagcg      1080
     aaggtcacac tgaataaaga caacttaact gctcctgtga aaaaaggaac caaggttggg      1140
     aagctgactg cggaatacac aggtgatgaa aaggattacg gattccttaa cagcgatctg      1200
     gctggcgtag accttgttac aaaagaaaat gtagaaaaag caaactggtt tgttttgaca      1260
     atgcgcagta tcggcggatt ttttgccgga atttggggaa gcattgttga tacggtaacc      1320
     ggctggtttt aa                                                          1332
//

If you have problems or comments...

PBIL Back to PBIL home page