(data stored in ACNUC7421 zone)

EMBL: AL009126.DARA

AL009126.DARA        Location/Qualifiers
FT   CDS_pept        39871..40200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="darA"
FT                   /locus_tag="BSU_00290"
FT                   /old_locus_tag="BSU00290"
FT                   /product="signal transduction receptor, cyclic di-AMP
FT                   binding"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10913081, 25433025; Product
FT                   type rc: receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00290"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11805"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="PDB:4RLE"
FT                   /db_xref="SubtiList:BG10093"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37538"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10913081, 25433025"
FT                   /protein_id="CAB11805.1"
FT                   /translation="MKLIVAVVQDQDSNRLLKTLTDHNFRVTKLATTGGFLKSGNTTFM
FT                   IGVEDIRVNKALSLIKENGQKRDQMIAPVSPMGGNADSYVPYPVEVEVGGATVFVLPVD
FT                   EFHQF"
     atgaaattga tagtggcagt tgtacaagat caggacagca acagactttt gaaaacctta        60
     acggatcaca acttcagagt cacaaagctt gcaacgacag gaggatttct taaatcaggc       120
     aatacaacgt ttatgatcgg tgtcgaggat atacgcgtca ataaagcgtt gagtctcatt       180
     aaagaaaacg ggcagaaacg tgatcagatg attgcccctg tatctccaat gggtggaaat       240
     gctgattcct atgtccctta tccagtcgaa gttgaagttg gcggagcgac agtatttgtc       300
     cttccagtcg atgaatttca tcaattttaa                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page