(data stored in SCRATCH zone)

EMBL: AL009126.DAYD

AL009126.DAYD        Location/Qualifiers
FT   CDS_pept        47706..48473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dayD"
FT                   /locus_tag="BSU_00390"
FT                   /old_locus_tag="BSU00390"
FT                   /product="D-amino acyl-tRNA deacylase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.6: Maintain"
FT                   /EC_number="3.1.-.-"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 10747959, 16014871, 16461678,
FT                   19332551; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00390"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11815"
FT                   /db_xref="GOA:P37545"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="SubtiList:BG10102"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37545"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11815.1"
FT                   /translation="MLFDTHAHLNAEQYDTDLEEVIERAKAEKVERIVVVGFDRPTITR
FT                   AMEMIEEYDFIYAAIGWHPVDAIDMTEEDLAWIKELSAHEKVVAIGEMGLDYHWDKSPK
FT                   DIQKEVFRNQIALAKEVNLPIIIHNRDATEDVVTILKEEGAEAVGGIMHCFTGSAEVAR
FT                   ECMKMNFYLSFGGPVTFKNAKKPKEVVKEIPNDRLLIETDCPFLTPHPFRGKRNEPSYV
FT                   KYVAEQIAELKEMTFEEIASITTENAKRLFRIN"
     atgttgtttg acactcacgc gcatttaaat gcagaacaat atgatactga tcttgaagag        60
     gttattgaac gggcaaaagc tgaaaaagtt gaacgaattg tcgtagttgg ttttgaccgt       120
     ccgacgatta cccgtgcgat ggaaatgatt gaggaatatg attttattta tgcagccatt       180
     ggctggcacc ctgttgacgc tattgacatg acagaggaag acttagcgtg gattaaagag       240
     ctttctgctc atgagaaagt ggtagcgata ggggaaatgg gactggatta tcattgggat       300
     aaatcaccta aagatattca aaaagaggtg tttagaaatc aaatcgcctt agcgaaagag       360
     gtcaatttgc ctattatcat tcataaccgt gatgcaacgg aggatgtcgt gaccattttg       420
     aaagaggaag gcgcagaagc tgtgggcgga atcatgcact gctttacagg aagtgcggaa       480
     gtggcaagag aatgcatgaa aatgaatttt tatttatcat ttgggggacc ggtgacattt       540
     aaaaatgcga agaaaccgaa ggaagtagtg aaggaaattc ccaatgaccg gctgctgatt       600
     gaaacggact gcccgtttct cacaccgcac cctttccgcg ggaaaagaaa tgagccaagc       660
     tatgtgaaat atgtggcaga acaaatcgcc gaattaaaag aaatgacctt tgaagagatt       720
     gcttccatca cgactgaaaa tgcgaaaaga cttttccgta taaactga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page