(data stored in ACNUC7421 zone)

EMBL: AL009126.DCK

AL009126.DCK         Location/Qualifiers
FT   CDS_pept        complement(22496..23149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dck"
FT                   /locus_tag="BSU_00140"
FT                   /old_locus_tag="BSU00140"
FT                   /product="deoxyadenosine/deoxycytidine kinase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="2.7.1.76"
FT                   /EC_number="2.7.1.74"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 6251049, 11078735; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00140"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11790"
FT                   /db_xref="GOA:P37529"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="SubtiList:BG10078"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37529"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:6251049, 11078735"
FT                   /protein_id="CAB11790.1"
FT                   /translation="MKEHHIPKNSIITVAGTVGVGKSTLTKTLAKRLGFKTSLEEVDHN
FT                   PYLEKFYHDFERWSFHLQIYFLAERFKEQKTIFEAGGGFVQDRSIYEDTGIFAKMHADK
FT                   GTMSKVDYKTYTSLFEAMVMTPYFPHPDVLIYLEGDLENILNRIEQRGREMELQTSRSY
FT                   WEEMHTRYENWISGFNACPVLKLRIEDYDLLNDENSIENIVDQIASVIHDNQKK"
     atgaaggaac atcatatccc taagaattca attattacag tagcaggaac agtaggtgtc        60
     ggaaaatcga ctttaacaaa aactttagct aaacggcttg gatttaaaac atcgttggag       120
     gaagtcgatc ataatccata tttggaaaag ttctatcatg attttgaacg ttggagcttt       180
     caccttcaaa tttacttctt agctgaacgc ttcaaagaac agaaaacaat ttttgaagcc       240
     ggcggaggtt ttgtacagga tcgttcgatt tatgaagata caggaatttt cgcaaaaatg       300
     catgctgata aagggacaat gtcaaaggtt gattataaga cttacacaag ccttttcgaa       360
     gcaatggtaa tgacaccgta tttcccacat ccagatgtgt tgatctattt agaaggagat       420
     ctggagaaca ttttaaaccg gattgaacaa cgcggccgtg agatggagct tcagacaagc       480
     cggtcttatt gggaagaaat gcatacacgc tacgagaact ggataagcgg ttttaatgcc       540
     tgccctgttt taaaacttcg cattgaagat tatgatcttc tgaacgacga aaactcgatt       600
     gaaaatattg tagatcaaat tgcttcagtt attcatgata atcaaaaaaa gtga             654
//

If you have problems or comments...

PBIL Back to PBIL home page