(data stored in ACNUC7421 zone)

EMBL: AL009126.DCTB

AL009126.DCTB        Location/Qualifiers
FT   CDS_pept        complement(496646..497698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctB"
FT                   /locus_tag="BSU_04440"
FT                   /old_locus_tag="BSU04440"
FT                   /product="membrane bound C4-dicarboxylate binding sensor
FT                   protein"
FT                   /function="16.12: Sense"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 1809844, 10708364, 11566984,
FT                   24375102; Product type rc: receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04440"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12251"
FT                   /db_xref="GOA:P96600"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="SubtiList:BG12072"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96600"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:1809844, 10708364, 11566984, 24375102"
FT                   /protein_id="CAB12251.1"
FT                   /translation="MKSLLACLALMIAGIATALFIGFHDHTGNKKIVYDDDQEGLQDQI
FT                   VFKFSHVVAENTPKGLAANKFADLVNEKSGGKIKIEVFPNGSLYSDIEEIEALQNGDVQ
FT                   FIAPSTSKLGMLSPEWGVLDLPYAFTDYNAVKKGLNGSIGTQLFDSLKKNQLKGLAYWT
FT                   NGFKQITTNQGPVKTPDDLKGQDLRIMQSDVIEDQFKLLGATPHQESFNSTFQLLENNV
FT                   VDGEENTISNIYSKKFYNVQDYLTISSHGYLGYAVMTDEHFWKAQTPETRRILTEAMKE
FT                   TTEWNETYAEQMNKEQLEEIKKNSAIHIYELSDKEKQEWMKRLDPVYRQYEPIFGRELI
FT                   RELLELRKDS"
     atgaagagtt tgcttgcatg tctcgcactg atgatcgctg gaattgcaac cgctttattt        60
     atcggattcc atgatcatac cggcaataaa aagattgttt atgatgacga ccaggaaggc       120
     ctgcaggatc aaatcgtgtt taaattcagc cacgtggttg ctgaaaatac gccaaaaggg       180
     ctggccgcca ataaattcgc tgatctggtg aacgaaaaat caggcggaaa aataaaaata       240
     gaagtatttc cgaatggaag cctgtactcg gacattgaag aaattgaagc attgcaaaac       300
     ggcgatgttc aatttatcgc cccctccaca tcgaagctcg gcatgctctc gcctgaatgg       360
     ggagtgctgg atctgccgta tgcatttaca gattacaacg ccgtcaaaaa agggctgaac       420
     ggaagcatcg gcacacagct gtttgattct ctaaagaaaa accaattgaa aggattggcc       480
     tattggacga acggctttaa gcaaatcaca acaaatcaag ggccggtcaa aacaccggat       540
     gacttaaaag ggcaggatct gcgcattatg caaagcgatg tgattgagga tcagttcaag       600
     ctgcttggcg caacacctca tcaggaatcc ttcaattcta cctttcagct gttagaaaac       660
     aatgtagtcg atggcgaaga aaatacaatt tcaaacatct attctaaaaa attttataat       720
     gttcaggact atttgacaat aagcagccac ggttatctcg gctacgctgt catgactgat       780
     gaacacttct ggaaggcgca aacaccagaa acaagacgca ttttgactga agcgatgaag       840
     gagacaacgg agtggaatga aacgtatgcc gaacaaatga acaaggagca gctggaagaa       900
     atcaaaaaga attctgctat acatatttat gagctgtcag ataaagagaa acaagaatgg       960
     atgaagcgtc ttgaccctgt ttaccggcag tatgagccca tctttggccg ggagctgatc      1020
     cgggaactgt tggagctgcg aaaagattca tag                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page