(data stored in ACNUC7421 zone)

EMBL: AL009126.DGK

AL009126.DGK         Location/Qualifiers
FT   CDS_pept        complement(23146..23769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgk"
FT                   /locus_tag="BSU_00150"
FT                   /old_locus_tag="BSU00150"
FT                   /product="deoxyguanosine kinase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="2.7.1.113"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11078735; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00150"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11791"
FT                   /db_xref="GOA:P37530"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="SubtiList:BG10079"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37530"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11078735"
FT                   /protein_id="CAB11791.1"
FT                   /translation="MNTAPFIAIEGPIGAGKTTLATMLSQKFGFPMINEIVEDNPYLDK
FT                   FYDNIKEWSFQLEMFFLCHRYKQLEDTSDHFLKKGQPVIADYHIYKNVIFAERTLSPHQ
FT                   LEKYKKIYHLLTDDLPKPNFIIYIKASLPTLLHRIEKRGRPFEKKIETSYLEQLISDYE
FT                   VAIKQLQEADPELTVLTVDGDSKDFVLNKSDFERIAAHVKELIV"
     atgaatacag ccccttttat tgcaatagaa ggtcctatcg gggcaggaaa aacaactctc        60
     gcaacgatgc tctcacaaaa attcggattc cctatgatca atgagattgt agaggataac       120
     ccgtaccttg ataagtttta tgacaatata aaggaatgga gcttccagct cgagatgttt       180
     tttctttgtc acagatacaa acagcttgaa gacaccagtg atcacttttt aaaaaaggga       240
     cagcctgtaa tagctgatta tcatatttat aaaaatgtga tttttgcgga acgaaccttg       300
     tctccacatc agctggaaaa atacaaaaag atatatcacc tgctaacgga tgatctgcca       360
     aagccgaatt tcatcattta cataaaggcc agtctgccta cattgctaca ccgcattgaa       420
     aaacgcgggc gcccctttga gaaaaaaatt gaaactagct atttggagca gctgatttca       480
     gattatgaag tcgccatcaa gcagctgcag gaagcagacc ctgaacttac agtgttaacc       540
     gtagatggtg attcaaagga tttcgttttg aataagagcg actttgaacg cattgccgcc       600
     catgtaaagg agcttatcgt atga                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page