(data stored in SCRATCH zone)

EMBL: AL009126.DISA

AL009126.DISA        Location/Qualifiers
FT   CDS_pept        107476..108558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="disA"
FT                   /locus_tag="BSU_00880"
FT                   /old_locus_tag="BSU00880"
FT                   /product="diadenylate cyclase; DNA integrity scanning
FT                   protein; cell cycle checkpoint DNA scanning protein"
FT                   /function="16.6: Maintain"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 16713562, 21566650, 24939848,
FT                   25616256, 27074767, 27150552, 28511132, 28961460; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00880"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11864"
FT                   /db_xref="GOA:P37573"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="SubtiList:BG10150"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37573"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:16713562, 21566650, 24939848, 25616256, 27074767,
FT                   27150552, 28511132, 28961460"
FT                   /protein_id="CAB11864.1"
FT                   /translation="MEKEKKGAKHELDLSSILQFVAPGTPLRAGMENVLRANTGGLIVV
FT                   GYNDKVKEVVDGGFHINTAFSPAHLYELAKMDGAIILSDSGQKILYANTQLMPDATISS
FT                   SETGMRHRTAERVAKQTGCLVIAISERRNVITLYQENMKYTLKDIGFILTKANQAIQTL
FT                   EKYKTILDKTINALNALEFEELVTFSDVLSVMHRYEMVLRIKNEINMYIKELGTEGHLI
FT                   KLQVIELITDMEEEAALFIKDYVKEKIKDPFVLLKELQDMSSYDLLDDSIVYKLLGYPA
FT                   STNLDDYVLPRGYRLLNKIPRLPMPIVENVVEAFGVLPRIIEASAEELDEVEGIGEVRA
FT                   QKIKKGLKRLQEKHYLDRQL"
     atggaaaaag agaaaaaagg ggcgaaacac gagttagacc tgtcatctat attgcagttt        60
     gttgctccgg gtacaccgct cagagcgggg atggaaaacg tcttgagagc aaatacaggc       120
     ggtctgattg ttgttggata taatgataaa gtaaaagaag tggtggacgg cggctttcac       180
     ataaacacgg ctttttctcc ggcgcattta tatgagctgg ctaaaatgga tggagcgatc       240
     attttaagtg attctggtca aaagatccta tacgcgaata ctcagctgat gccggatgcc       300
     acaatttctt catcagaaac aggaatgcgg cacagaactg ccgaaagagt agctaagcaa       360
     actggctgtc ttgtaatcgc catttctgaa agaagaaatg tcataacgtt atatcaggaa       420
     aacatgaagt atacactaaa agacatagga tttattttaa ccaaggcgaa ccaagccatt       480
     caaacacttg aaaaatataa gacaatcctc gataaaacga ttaatgcact gaacgcgtta       540
     gagtttgagg aacttgttac cttcagtgat gtcttgtctg tcatgcatcg ttatgaaatg       600
     gtactgagaa tcaaaaacga aattaatatg tatatcaaag agctggggac agaagggcat       660
     ctgatcaaac tgcaagtcat tgaattgatt acggatatgg aagaagaggc cgctttattt       720
     attaaggact atgtaaaaga aaagattaaa gatccgtttg ttctcttgaa ggagctgcag       780
     gatatgtcca gttatgatct gctggatgat tccattgtgt ataagcttct cggttaccct       840
     gcttctacta atcttgatga ttatgtattg ccgagaggat acaggctgtt aaataagata       900
     ccgcgtcttc cgatgccgat tgttgaaaat gttgtagaag catttggagt cctgccaagg       960
     attattgagg cgagtgcaga agaattagat gaagtagagg gaatcggtga agtacgagcc      1020
     caaaaaatca aaaaaggatt aaaacgcctg caagagaagc attatttaga cagacaactg      1080
     tga                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page