(data stored in SCRATCH zone)

EMBL: AL009126.DIVIC

AL009126.DIVIC       Location/Qualifiers
FT   CDS_pept        69168..69545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="divIC"
FT                   /locus_tag="BSU_00620"
FT                   /old_locus_tag="BSU00620"
FT                   /product="cell-division initiation protein"
FT                   /function="16.9: Replicate"
FT                   /function="16.13: Shape"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10844672, 11283287, 11994149,
FT                   12682299, 16936019, 20870765, 22720735; Product type f:
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00620"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11838"
FT                   /db_xref="GOA:P37471"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR039076"
FT                   /db_xref="SubtiList:BG10125"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37471"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10844672, 11283287, 11994149, 12682299, 16936019,
FT                   20870765, 22720735"
FT                   /protein_id="CAB11838.1"
FT                   /translation="MNFSRERTITEIQNDYKEQVERQNQLKKRRRKGLYRRLTVFGALV
FT                   FLTAIVLASSVWSQTSSLSAKEEKKEQLEKELKSLKTKQTDLKEEISKLKDEDYVTELA
FT                   RRDLFMSGDGEIIFNVEKKSK"
     ttgaattttt ccagggaacg aacgataact gaaatacaaa acgactataa agaacaagta        60
     gaacggcaaa atcagctgaa gaaacgaaga cgcaaagggc tgtacagacg gttaactgta       120
     ttcggcgccc tagtattcct gacggcaatt gtgctggcaa gctctgtatg gtcccaaaca       180
     tcttccctta gtgcaaaaga agaaaagaaa gaacagcttg aaaaagaact gaaaagttta       240
     aagacaaaac aaacggattt aaaagaagaa atatccaaat tgaaggatga ggattacgtc       300
     acagagcttg ccagaaggga cttattcatg tctggagacg gagaaattat cttcaatgtg       360
     gagaagaaga gcaagtag                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page