(data stored in ACNUC7421 zone)

EMBL: AL009126.DNAH

AL009126.DNAH        Location/Qualifiers
FT   CDS_pept        42499..42858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaH"
FT                   /locus_tag="BSU_00330"
FT                   /old_locus_tag="BSU00330"
FT                   /product="subunit of the DNA replication complex"
FT                   /function="16.9: Replicate"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15927750, 16461910, 19737352,
FT                   21895792, 23909787, 28166228; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00330"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11809"
FT                   /db_xref="GOA:P37542"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="PDB:5DOL"
FT                   /db_xref="SubtiList:BG10097"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37542"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15927750, 16461910, 19737352, 21895792, 23909787,
FT                   28166228"
FT                   /protein_id="CAB11809.1"
FT                   /translation="MDKKELFDTVINLEEQIGSLYRQLGDLKQHIGEMIEENHHLQLEN
FT                   KHLRKRLDDTTQQIEKFKADKKESKTQKTEQTDIGEGYDNLARLYQEGFHICNVHYGSV
FT                   RKEDCLFCLSFLNKK"
     ttggataaaa aagagttatt tgatacagtc attaacttag aagaacaaat tggctcactg        60
     taccggcagc tgggggattt gaagcagcat atcggtgaga tgattgagga aaatcatcat       120
     ttacagcttg aaaacaagca tttgcgcaaa cggctggacg atacgacgca gcagattgaa       180
     aagttcaaag ctgataaaaa agaatcaaaa acacagaaga cagagcaaac tgatataggg       240
     gaaggatatg ataatctggc acgtctgtat caagaaggat ttcatatctg caatgtccac       300
     tatggaagtg ttcgaaaaga ggattgtctt ttctgtctgt cattcttaaa taaaaaatag       360
//

If you have problems or comments...

PBIL Back to PBIL home page