(data stored in SCRATCH zone)

EMBL: AL009126.DNAN

AL009126.DNAN        Location/Qualifiers
FT   CDS_pept        1939..3075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="BSU_00020"
FT                   /old_locus_tag="BSU00020"
FT                   /product="DNA polymerase III (beta subunit)"
FT                   /function="16.9: Replicate"
FT                   /EC_number="2.7.7.7"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 2846289, 11395445, 12682299,
FT                   20453097, 23228104, 28878042; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00020"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11778"
FT                   /db_xref="GOA:P05649"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="PDB:4TR6"
FT                   /db_xref="PDB:6E8D"
FT                   /db_xref="SubtiList:BG10066"
FT                   /db_xref="UniProtKB/Swiss-Prot:P05649"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:2846289, 11395445, 12682299, 20453097, 23228104,
FT                   28878042"
FT                   /protein_id="CAB11778.1"
FT                   /translation="MKFTIQKDRLVESVQDVLKAVSSRTTIPILTGIKIVASDDGVSFT
FT                   GSDSDISIESFIPKEEGDKEIVTIEQPGSIVLQARFFSEIVKKLPMATVEIEVQNQYLT
FT                   IIRSGKAEFNLNGLDADEYPHLPQIEEHHAIQIPTDLLKNLIRQTVFAVSTSETRPILT
FT                   GVNWKVEQSELLCTATDSHRLALRKAKLDIPEDRSYNVVIPGKSLTELSKILDDNQELV
FT                   DIVITETQVLFKAKNVLFFSRLLDGNYPDTTSLIPQDSKTEIIVNTKEFLQAIDRASLL
FT                   AREGRNNVVKLSAKPAESIEISSNSPEIGKVVEAIVADQIEGEELNISFSPKYMLDALK
FT                   VLEGAEIRVSFTGAMRPFLIRTPNDETIVQLILPVRTY"
     atgaaattca cgattcaaaa agatcgtctt gttgaaagtg tccaagatgt attaaaagca        60
     gtttcatcca gaaccacgat tcccattctg actggtatta aaattgttgc atcagatgat       120
     ggagtatcct ttacagggag tgactcagat atttctattg aatccttcat tccaaaagaa       180
     gaaggagata aagaaatcgt cactattgaa cagcccggaa gcatcgtttt acaggctcgc       240
     ttttttagtg aaattgtaaa aaaattgccg atggcaactg tagaaattga agtccaaaat       300
     cagtatttga cgattatccg ttctggtaaa gctgaattta atctaaacgg actggatgct       360
     gatgaatatc cgcacttgcc gcagattgaa gagcatcatg cgattcagat cccaactgat       420
     ttgttaaaaa atctaatcag acaaacagta tttgcagtgt ccacctcaga aacacgccct       480
     atcttgacag gtgtaaactg gaaagtggag caaagtgaat tattatgcac tgcaacggat       540
     agccaccgtc ttgcattaag aaaggcgaaa cttgatattc cagaagacag atcttataac       600
     gtcgtgattc cgggaaaaag tttaactgaa ctcagcaaga ttttagatga caaccaggaa       660
     cttgtagata tcgtcatcac agaaacccaa gttctgttta aagcgaaaaa cgtcttgttc       720
     ttctcacggc ttctggacgg gaattatcca gacacaacca gcctgattcc gcaagacagc       780
     aaaacagaaa tcattgtgaa cacaaaagaa ttccttcagg ccattgatcg tgcatctctt       840
     ttagctagag agggacgcaa caacgttgta aaactgtccg caaaaccggc tgaatccatt       900
     gaaatttctt ccaattcgcc agaaatcggt aaagttgtgg aagcaattgt tgcggatcaa       960
     attgaaggtg aggaattaaa tatctctttt agtccaaaat atatgctgga tgcactaaag      1020
     gtgcttgaag gagcagaaat acgcgtaagc tttacaggcg caatgagacc tttcttaatt      1080
     cgcacgccga atgatgaaac gattgtacag cttatccttc ctgtcagaac ctattaa         1137
//

If you have problems or comments...

PBIL Back to PBIL home page