(data stored in SCRATCH zone)

EMBL: AL009126.DNAX

AL009126.DNAX        Location/Qualifiers
FT   CDS_pept        26814..28505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="BSU_00190"
FT                   /old_locus_tag="BSU00190"
FT                   /product="DNA polymerase III subunit tau subunit"
FT                   /function="16.9: Replicate"
FT                   /EC_number="2.7.7.7"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9341154, 10844689, 12466528,
FT                   12974630, 14757052, 15927750, 25850333, 26786318; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00190"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11795"
FT                   /db_xref="GOA:P09122"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="SubtiList:BG10083"
FT                   /db_xref="UniProtKB/Swiss-Prot:P09122"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9341154, 10844689, 12466528, 12974630, 14757052,
FT                   15927750, 25850333, 26786318"
FT                   /protein_id="CAB11795.2"
FT                   /translation="MSYQALYRVFRPQRFEDVVGQEHITKTLQNALLQKKFSHAYLFSG
FT                   PRGTGKTSAAKIFAKAVNCEHAPVDEPCNECAACKGITNGSISDVIEIDAASNNGVDEI
FT                   RDIRDKVKFAPSAVTYKVYIIDEVHMLSIGAFNALLKTLEEPPEHCIFILATTEPHKIP
FT                   LTIISRCQRFDFKRITSQAIVGRMNKIVDAEQLQVEEGSLEIIASAADGGMRDALSLLD
FT                   QAISFSGDILKVEDALLITGAVSQLYIGKLAKSLHDKNVSDALETLNELLQQGKDPAKL
FT                   IEDMIFYFRDMLLYKTAPGLEGVLEKVKVDETFRELSEQIPAQALYEMIDILNKSHQEM
FT                   KWTNHPRIFFEVAVVKICQTSHQSAADLPEVDMLMKKIQQLEQEVERLKTTGIKAAAES
FT                   PKKEAPRVPKGGKSNYKAPVGRIHEILKEATRPDLDLLRNSWGKLLAHLKQQNKVSHAA
FT                   LLNDSEPVAAGSAAFVLKFKYEIHCKMVAEDNNGVRTNLEQILESMLGKRMDLIGVPEA
FT                   QWGKIREEFLEDHQQENEGSNEPAEEDPLIAEAKKLVGADLIEIKD"
     gtgagttacc aagctttata tcgagtattc aggcctcagc gctttgaaga tgtggtcgga        60
     caagaacaca ttacaaaaac gctgcaaaat gcccttttgc aaaaaaagtt ttctcacgcc       120
     tatctgtttt ccgggcctag aggaaccgga aaaaccagtg cagccaaaat atttgctaag       180
     gctgtcaact gtgaacatgc tcctgttgat gagccatgca acgaatgtgc ggcctgtaaa       240
     gggataacaa acgggtcaat atccgatgtc atagaaattg acgccgcttc taataacggt       300
     gttgatgaga ttcgtgacat tcgcgataaa gtgaagtttg ccccatcggc cgtcacatat       360
     aaggtatata tcatagatga ggtgcatatg ctttctatcg gcgcttttaa tgcattacta       420
     aaaacattag aagagccgcc tgagcattgt attttcatat tagcaacaac tgaaccgcac       480
     aaaattcctt taaccattat ctctagatgt cagcgttttg actttaaacg aattacctcc       540
     caagcgattg taggccgcat gaataaaatt gttgatgctg aacagctgca agtggaggaa       600
     ggatcgctgg aaatcatcgc gagtgctgca gacggaggga tgagggatgc cctgagcctt       660
     cttgatcagg ccatatcatt cagcggcgat atcctgaaag tcgaagatgc gcttttaatt       720
     acgggtgctg tttctcaatt atatatcggg aagcttgcaa aatccctgca tgataaaaac       780
     gtttctgacg cactggaaac attaaatgaa ttgcttcagc aaggaaaaga tccagctaag       840
     ctgatagaag atatgatttt ctatttcagg gacatgctgc tgtacaaaac agcccctggc       900
     ttagagggag tgcttgagaa agtaaaagtc gatgaaacgt tccgggaact aagtgaacaa       960
     attccggctc aggccctata tgaaatgatt gatattctga acaagagcca tcaggaaatg      1020
     aaatggacaa atcatccgcg tatctttttc gaagtggccg ttgtgaagat ttgccaaacc      1080
     tcacatcaat ctgctgctga tctcccggaa gtggatatgc tgatgaaaaa aatccagcag      1140
     ctcgaacagg aagtagagcg gctcaaaaca acgggcataa aagcagctgc ggaaagcccg      1200
     aaaaaagaag cgccgcgtgt gccaaagggc gggaaatcca attacaaagc gccagtaggc      1260
     agaattcatg agattttgaa ggaagccaca agaccggatc ttgatctgct cagaaacagt      1320
     tggggcaagc ttcttgctca tctcaaacag caaaacaaag tatcacatgc cgctttgctg      1380
     aatgacagtg aacctgtggc tgccggatcg gcggcatttg ttctgaaatt caaatatgaa      1440
     attcattgta aaatggtcgc tgaggataac aacggagtcc ggactaatct tgagcagatt      1500
     ttagaatcga tgctcggaaa aagaatggat ttgattggcg ttccagaagc acaatggggt      1560
     aaaataagag aagaattttt agaagatcat cagcaggaaa atgaaggatc aaatgaaccg      1620
     gctgaagaag acccgcttat tgccgaagcg aaaaagcttg ttggagcgga tttaattgaa      1680
     ataaaagact aa                                                          1692
//

If you have problems or comments...

PBIL Back to PBIL home page