(data stored in SCRATCH zone)

EMBL: AL009126.DUSB

AL009126.DUSB        Location/Qualifiers
FT   CDS_pept        87634..88635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dusB"
FT                   /locus_tag="BSU_00810"
FT                   /old_locus_tag="BSU00810"
FT                   /product="tRNA-dihydrouridine synthase B"
FT                   /function="16.6: Maintain"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.3: Control"
FT                   /EC_number="1.-.-.-"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 11983710, 15698474, 26112661;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00810"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11857"
FT                   /db_xref="GOA:P37567"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="SubtiList:BG10143"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37567"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11857.1"
FT                   /translation="MFKIGDIQLKNRVVLAPMAGVCNSAFRLTVKEFGAGLVCAEMVSD
FT                   KAILYNNARTMGMLYIDEREKPLSLQIFGGKKETLVEAAKFVDQNTTADIIDINMGCPV
FT                   PKITKCDAGAKWLLDPDKIYEMVSAVVDAVNKPVTVKMRMGWDEDHIFAVKNAQAVERA
FT                   GGKAVALHGRTRVQMYEGTANWDIIKEVKQSVSIPVIGNGDVKTPQDAKRMLDETGVDG
FT                   VMIGRAALGNPWMIYRTVQYLETGKLKEEPQVREKMAVCKLHLDRLIDLKGENVAVREM
FT                   RKHAAWYLKGVKGNANVRNEINHCETREEFVQLLDAFTVEVEAKELQNAKVG"
     ttgttcaaaa tcggagatat tcaattgaaa aaccgggttg tgctcgcacc tatggctggt        60
     gtctgcaact ctgcgttcag attgactgta aaggaattcg gagccggatt ggtatgcgct       120
     gaaatggtca gtgacaaagc gatcctttac aacaatgcaa gaacaatggg tatgctttat       180
     attgatgaac gtgagaaacc actgagcctt caaattttcg gaggaaaaaa ggaaaccctt       240
     gtggaagcgg cgaagtttgt agaccaaaac acaactgctg atatcattga tattaacatg       300
     ggatgtcccg tgccgaagat tacaaaatgc gatgcgggag ccaaatggct tctcgatcct       360
     gataagattt acgaaatggt ttctgcagta gtggatgctg ttaataagcc agttacagtg       420
     aaaatgagaa tgggctggga tgaagaccac attttcgcag tgaaaaatgc acaggctgta       480
     gaacgtgcgg gcggtaaagc agtggcgctt cacggccgta cgagagtgca gatgtacgaa       540
     ggaacggcaa actgggatat catcaaagaa gtaaaacaat cagtatcgat tccggttatc       600
     ggaaacggcg atgttaagac accgcaggat gctaagcgta tgctcgatga gacaggagta       660
     gacggggtca tgatcggacg cgctgcattg ggtaacccgt ggatgattta ccgtacggtt       720
     cagtatcttg aaacaggtaa attaaaagaa gagccgcaag tacgcgaaaa aatggccgta       780
     tgcaaactgc atcttgaccg cctgattgac ttaaaaggtg aaaacgtagc ggtaagagaa       840
     atgagaaagc acgctgcatg gtatctgaaa ggcgtgaaag gcaatgcgaa cgttcgtaat       900
     gaaatcaatc attgcgagac gagagaagag tttgtacagc ttttagatgc atttacggtt       960
     gaagttgagg caaaagagct tcaaaatgca aaagtaggat aa                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page