(data stored in ACNUC7421 zone)

EMBL: AL009126.EBFC

AL009126.EBFC        Location/Qualifiers
FT   CDS_pept        28529..28852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ebfC"
FT                   /locus_tag="BSU_00200"
FT                   /old_locus_tag="BSU00200"
FT                   /product="nucleoid associated protein"
FT                   /function="16.3: Control"
FT                   /function="16.9: Replicate"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 16740939, 19208644, 19594923,
FT                   20639362, 22333191, 22544270; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00200"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11796"
FT                   /db_xref="GOA:P24281"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="SubtiList:BG10084"
FT                   /db_xref="UniProtKB/Swiss-Prot:P24281"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11796.1"
FT                   /translation="MRGGMGNMQKMMKQMQKMQKDMAKAQEELAEKVVEGTAGGGMVTV
FT                   KANGQKEILDVIIKEEVVDPEDIDMLQDLVLAATNEALKKVDEITNETMGQFTKGMNMP
FT                   GLF"
     atgcgtggcg gaatgggtaa tatgcaaaaa atgatgaaac aaatgcaaaa aatgcaaaag        60
     gacatggcga aggctcaaga agagcttgca gaaaaggttg ttgaaggaac tgcaggcggc       120
     ggtatggtaa cagtaaaagc aaacggccaa aaagaaatcc tggatgttat catcaaagaa       180
     gaagtcgttg atcctgaaga tattgatatg cttcaagatt tagtgcttgc tgcaacgaat       240
     gaagctttga aaaaagttga cgaaatcaca aacgaaacaa tgggtcaatt tacaaaggga       300
     atgaacatgc caggtttatt ctag                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page