(data stored in SCRATCH zone)

EMBL: AL009126.ECFA

AL009126.ECFA        Location/Qualifiers
FT   CDS_pept        150443..151288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecfA"
FT                   /locus_tag="BSU_01450"
FT                   /old_locus_tag="BSU01450"
FT                   /product="energizing coupling factor of ABC influx
FT                   transporter (ATP-binding protein)"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 12110480, 21135102, 26052893;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01450"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11921"
FT                   /db_xref="GOA:P40735"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="SubtiList:BG11067"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40735"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11921.2"
FT                   /translation="MNQNQLISVEDIVFRYRKDAERRALDGVSLQVYEGEWLAIVGHNG
FT                   SGKSTLARALNGLILPESGDIEVAGIQLTEESVWEVRKKIGMVFQNPDNQFVGTTVRDD
FT                   VAFGLENNGVPREEMIERVDWAVKQVNMQDFLDQEPHHLSGGQKQRVAIAGVIAARPDI
FT                   IILDEATSMLDPIGREEVLETVRHLKEQGMATVISITHDLNEAAKADRIIVMNGGKKYA
FT                   EGPPEEIFKLNKELVRIGLDLPFSFQLSQLLRENGLALEENHLTQEGLVKELWTLQSKM
FT                   "
     atgaatcaaa atcagttgat atcggtagag gatatcgtat ttcgatatcg gaaggacgca        60
     gaaagacgag cactagacgg cgtctccctg caggtgtatg agggtgaatg gcttgcaatc       120
     gtaggtcata acggttcagg gaaatcaaca ctggcccggg cattgaatgg tttaattctt       180
     cctgaatcag gcgacattga ggttgccggg attcaattga cagaggaatc tgtttgggaa       240
     gtgcgtaaga agataggtat ggtctttcaa aatccggata accaatttgt cggaacgact       300
     gttcgcgatg atgtggcttt tggtttagaa aacaatggtg taccgcggga agaaatgatt       360
     gagagagtag actgggcagt aaaacaggtg aatatgcaag attttctcga tcaagagccg       420
     caccatctct ccggaggcca aaagcagaga gttgcgattg cgggggttat tgccgcacgt       480
     cctgatatta ttatcttaga tgaagcaaca tccatgcttg atccgatcgg gcgagaagaa       540
     gtgcttgaaa cggtaagaca tttaaaagag cagggcatgg cgactgtcat atccattaca       600
     catgacctga atgaggcagc aaaagcagac aggatcattg tcatgaatgg cggtaaaaaa       660
     tatgctgaag ggccgcctga agagattttt aaattgaata aagaacttgt tcgaattggg       720
     cttgatttac ccttctcatt ccagcttagc cagcttttaa gagaaaatgg actggctttg       780
     gaagaaaacc atttgactca ggaagggctg gtgaaagagc tgtggacatt acaatcaaag       840
     atgtag                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page